KEGG   Populus trichocarpa (black cottonwood): POPTR_0002s03500gHelp
Entry
POPTR_0002s03500g CDS       T01077                                 

Gene name
POPTRDRAFT_710083
Definition
dihydroflavonol reductase family protein
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:pop00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    POPTR_0002s03500g (POPTRDRAFT_710083)
Enzymes [BR:pop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     POPTR_0002s03500g (POPTRDRAFT_710083)
    1.1.1.234  flavanone 4-reductase
     POPTR_0002s03500g (POPTRDRAFT_710083)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LGII
AA seq 346 aa AA seqDB search
MGTEAETVCVTGASGFIGSWLIMRLLEKGYAVRATVRDPDNMKKVTHLLELPKASTHLTL
WKADLSVEGSYDEAIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMRACANSKTV
RKIVFTSSAGTVDVEEKRKPVYDESCWSDLDFVQSIKMTGWMYFVSKTLAEQAAWKFAKE
NNLDFISIIPTLVVGPFIMQSMPPSLLTALSLITGNEAHYGILKQGHYVHLDDLCMSHIF
LYENPKAEGRYICNSDDANIHDLAKLLREKYPEYNVPAKFKDIDENLACVAFSSKKLTDL
GFEFKYSLEDMFAGAVETCREKGLIPLSHRKQVVEECKENEVVPAS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgggaacagaagctgaaacagtgtgtgtgacaggtgcatcaggcttcatcggatcatgg
ctaattatgcgactactagagaaaggttatgctgtccgagccaccgtccgagaccctgat
aacatgaagaaggtgacgcatttgctggaattgccaaaggcatcaacccacttgacttta
tggaaagctgatctttctgtagaggggagttatgatgaagcaattcaagggtgcacagga
gtgttccatgttgccactcccatggattttgagtccaaggaccccgagaacgaggtgatc
aagccaacaatcaacggagtactggacatcatgagagcatgtgccaattcaaaaacagtt
agaaagatagtattcacgtcatctgcaggaactgtggatgttgaagaaaagagaaaacca
gtgtacgatgaaagctgctggagtgatttggactttgttcagagtataaaaatgactgga
tggatgtatttcgtgtccaagactttagcagagcaagctgcatggaagtttgctaaagag
aataacctggattttatcagcatcataccaactcttgttgttggcccatttatcatgcaa
tcaatgccaccaagtctcctgacagcactttcattgatcactggaaatgaagctcattat
gggattttaaagcagggacattatgtgcacttggatgacctctgcatgtctcacatcttt
ttgtatgagaatccaaaagcagagggccgctacatctgcaactcggatgatgctaacatt
cacgatcttgctaaattactccgagaaaaatacccagaatacaatgtccctgctaagttc
aaagatattgatgagaatttggcgtgtgttgctttctcatccaaaaagctgacggacttg
ggttttgagttcaaatacagcttggaggacatgttcgcaggtgctgtggaaacatgcaga
gaaaagggactaattcccctttctcataggaaacaagtcgtcgaggaatgcaaagaaaat
gaagtggtccctgcgtcctga

DBGET integrated database retrieval system