KEGG   Populus trichocarpa (black cottonwood): POPTR_0002s09010gHelp
Entry
POPTR_0002s09010g CDS       T01077                                 

Gene name
POPTRDRAFT_551514
Definition
hypothetical protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
Enzymes [BR:pop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     POPTR_0002s09010g (POPTRDRAFT_551514)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LGII
AA seq 445 aa AA seqDB search
MGSIDTPKNPENGARTLPPATDAYATYEGDKNGMPSRATEMTLPVESEAIKKRKASMLPL
EVGTRVMCRWRDSKYHPVKVIERRKMQSVGSIDYEYYVHYTEFNRRLDEWVKLEQLDLDS
VETVVDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELG
RYEIETWYFSPFPPEYNDCLKLYFCEFCLNFMKRKEQLQRHMKKCDLKHPPGDEIYRSGT
LSMFEIDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYILCECDDRGCHMVGYFSKE
KHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYW
TRVLLDILKRHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVICADPKVLDRH
LKAAGRGGLEVDVSKLIWTPYKEQG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgggttcgatcgacaccccaaaaaatcccgagaacggcgccagaactctgcctcccgca
accgacgcctacgctacgtacgaaggcgataaaaacggaatgccttcacgcgccaccgaa
atgacgcttccggtcgaatccgaagccattaagaagaggaaagcgagcatgttaccgctc
gaggtaggtactcgcgttatgtgtcgttggagagacagcaagtaccatccggttaaggtc
atcgagcgccgtaagatgcagtctgttgggtccattgattacgagtactacgtgcattat
acagagttcaataggaggctcgatgaatgggtgaagcttgaacaactagatcttgattca
gtagagacagttgtcgatgaaaaagtggaggacaaggtaacaagcttgaaaatgacacgc
caccagaaacggaagattgatgagacgcatgtggagggccatgaggagcttgatgctgcc
agcttacgcgagcatgaggaattcacaaaagtaaaaaatatagccaccattgagcttgga
agatatgagattgagacatggtacttctcgcctttcccaccggaatacaatgattgtttg
aagctttacttttgtgaattttgcctcaacttcatgaagcgtaaagaacagcttcaaagg
catatgaagaagtgtgatctcaagcaccctcctggtgatgaaatttatcgaagtggcaca
ttgtcaatgtttgagatagatggcaaaaagaacaaggtttatgggcagaatctttgttat
ttggcgaagttgtttcttgatcacaagaccctttattatgatgttgacctgtttctattt
tacattttgtgtgaatgtgatgatcgaggatgccacatggttggatatttttccaaggaa
aagcattctgaggagtcgtataatttggcatgcatcctcactcttcctccttatcaaagg
aaaggctatgggaagtttttaattgccttctcatatgaactttccaagaaagaaggtaaa
gttggcacacctgaaagacccctttcagacctggggttgttgagctatagaggatattgg
acccgagttcttttagatatcttgaaaaggcacaagggaaatatttctattaaggagctt
agtgacatgacagcaataaaggcagaggatattttgactacccttcagagcctagaatta
attcagtacaggaaagggcagcatgtaatatgtgcagatccgaaggtcctggatcgccat
ctaaaagctgctggaaggggtggtcttgaggttgatgttagcaaattgatctggactcct
tacaaagaacaaggttga

DBGET integrated database retrieval system