KEGG   Populus trichocarpa (black cottonwood): POPTR_0002s18740gHelp
Entry
POPTR_0002s18740g CDS       T01077                                 

Gene name
POPTRDRAFT_755736
Definition
mRNA for protoporphyrinogen oxidase family protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pop00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    POPTR_0002s18740g (POPTRDRAFT_755736)
Enzymes [BR:pop01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     POPTR_0002s18740g (POPTRDRAFT_755736)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 543 aa AA seqDB search
MTTFIDFSLLRPTTPSLIPSSFSKFSTPRPFKLRCSLTEESATITPSKLNGEAQSNGGHS
AAADCVIVGGGISGLCIAQALATKHRDVAPNVIVTEARDRVGGNITTLERDGYLWEEGPN
SFQPSDPMLTMVVDSGLKEDLVLGDPNAPRFVLWNGKLRPVPGKPTDLPFFDLMSIGGKL
RAGFGALGLRPPPPGHEESVEEFVRRNLGDEVFERLIEPFCSGVYAGDPSKLSMKAAFGK
VWNLEQTGGSIIGGTFKTIQERRKNPKPPRDPRLPTPKGQTVGSFRKGLAMLPDAIATRL
GSNVKLSWKLASVIKLDSGGYSLTYETPEGLVSLLSKSVVFTIPSHIASTLLHPLSATAA
DALSKFYYPPVAAVSVSYPKEAIRPERLIDGELKGFGQLHPRSQGVETLGTIYSSSLFPN
RAPTGRILLLNYIGGTTNPGIVSKTESELVEAVDRDLRKMLINPNATDPLVLGVRVWPQA
IPQFLIGHFDILDAARDALKAKGLQGLFLGGNYVSGVALGRCVEGAYEVAAEVTDFLSQY
ANK
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgactaccttcattgacttctctcttctccgtccaacaacgccctctctcatcccctcc
tcattctcaaaattctccactcccagaccctttaaactccgatgctccctaaccgaagag
tcagctacaattactccgtcgaagctcaacggcgaagcccagtccaacggcggacattct
gccgcggcggattgtgtcattgtcggaggaggcattagtgggctctgtatcgcccaggct
cttgcaaccaaacaccgggatgttgctcccaatgtgattgtcaccgaagccagagatcgc
gtcggtggcaacattaccaccctggaaagagatggttatctatgggaagagggccccaac
agtttccagccttccgatcctatgctcactatggtggtggatagtggattaaaagaggat
ttggtactaggggatccaaatgcgccccgttttgtattgtggaatgggaagttaaggcca
gtaccaggcaagcctactgacttgccatttttcgacttgatgagtattggtggcaaactc
agagctggatttggtgctcttggacttcggcctccgccaccaggacatgaagaatcagtt
gaagagtttgtgcggcgtaaccttggtgatgaggttttcgagcgattgattgagcctttt
tgttcaggtgtttatgcgggtgatccttccaaactaagcatgaaagcggcttttggaaaa
gtttggaacctggagcaaactggtggtagtatcattggtggaactttcaaaacaatccag
gagagaagaaaaaaccccaagccacctcgagacccgcgcctaccaacaccaaagggccaa
actgttggatcttttagaaaaggacttgctatgttgcctgatgcaatagcaacaaggttg
ggtagcaatgtaaaattatcttggaagctggcaagcgtcattaaattggatagtggtgga
tatagtttgacatatgaaacacctgaaggattagtttctctactgagcaaaagcgtggtc
ttcactattccatcccacattgcaagcactctactgcatccgctttctgctacagctgca
gatgcactatcaaaattttattacccaccagtagcagcagtgtctgtttcatatccaaag
gaagcaattagaccagaacgcttaatagatggtgaactcaaggggtttggtcagctgcat
ccacgaagccaaggggtggaaacattaggaactatatatagctcatctctttttcctaat
cgtgctcctactggaaggattttgctcttgaactacattggaggaactactaaccctgga
atagtgtctaagacagagagtgaacttgtagaagcagttgatcgtgatttgagaaagatg
cttataaatcctaacgcgacagatcctcttgtattaggggtgagagtatggccacaagcc
attcctcagttcttgattggtcattttgacatcctagatgctgcaagagatgctctcaag
gctaaagggttgcaggggctgtttcttggggggaactatgtatctggtgttgcgttgggc
cgatgtgtagaaggagcttatgaagttgctgctgaggtaactgatttcctctcccagtat
gccaacaaatag

DBGET integrated database retrieval system