KEGG   Populus trichocarpa (black cottonwood): POPTR_0003s02540gHelp
Entry
POPTR_0003s02540g CDS       T01077                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:pop00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    POPTR_0003s02540g
Enzymes [BR:pop01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     POPTR_0003s02540g
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     POPTR_0003s02540g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 407 aa AA seqDB search
MPELPEVEAARRAIEEHCIGKKIKKAIIADDSKVIDGVSPSDFVAALVGKTIVSALRKGK
NLWLQLDSPPFPSFQFGMAGAVYIKGVAVTKYKRSAVNDSDEWPSKYSKFFVQLDDGLEL
SFTDKRRFAKVRLLEDPASKPPISELGPDALLEPMTVDELHGSLSKKKVAIKALLLDQSF
VSGIGNWIADEVLYQARIHPLQIASSLSRESSATLHKCIKEVIEKAVEVGADSSQFPNNW
IFHSREKKSKKTFIDGKEIDFIVAGGRTTAYVPGLQKLNGNQAGKAVGKPKARTSKKKRD
GDDDDNDNNEDGGSEPTSEDEKIARKAKSKRELRPKGPGKKPSAKRKSKASDTDSEEDEG
AATAAAADDDQKKKPRRVTSRKQVMVGKAPKKLVNNQNTNKPRKKVK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgccagagctaccggaggtagaggcggcgagaagggcgatagaggaacattgcataggg
aagaagataaagaaggccatcattgccgacgacagtaaagtcatcgatggagtctctcct
tctgattttgtggcagcacttgttggcaaaactattgtctctgctcttagaaagggaaag
aacttgtggctccaactcgactcccctcccttcccttcctttcagttcgggatggctggg
gctgtatatattaaaggagttgcggttaccaaatataaaaggtctgcagtaaatgactct
gatgagtggccttccaaatattcaaagttttttgtccaactagatgatggtctggagctt
tctttcactgacaagaggcgatttgctaaagtccgcttgcttgaagatccagcttctaag
cccccgatatctgagttgggccccgatgcattactggagccgatgacagttgatgaactt
catggatccctaagcaagaagaaagttgcaattaaggctctattacttgatcagagtttt
gtatctggaattggtaactggattgcagatgaagtgctataccaagctagaattcatcca
ctgcagattgcttccagcttatccagagaaagttctgcaactttacacaagtgcatcaag
gaggtgattgaaaaagcagtagaagttggggcagatagtagtcagttcccaaacaattgg
atttttcattctagggaaaagaagtctaagaagactttcattgatgggaaggagattgat
tttattgttgctggtggtaggacaacggcctatgtaccggggttacagaagctaaatgga
aaccaagctgggaaagcagtgggaaaaccaaaagcaagaacttcaaagaaaaaaagagat
ggggatgatgatgacaatgacaacaatgaagatggtggcagcgaaccaacttccgaggat
gaaaaaattgcaagaaaggccaaatcaaagagagagttgaggcctaaaggtcctgggaaa
aagccttcagctaaaagaaaatccaaagcaagtgatactgacagtgaagaagatgagggt
gctgccaccgccgccgccgccgacgacgatcaaaagaaaaaacctagaagagtgaccagc
agaaaacaagtcatggtaggtaaagcacccaagaaattggttaacaatcaaaatactaac
aaaccaaggaagaaagtgaagtag

DBGET integrated database retrieval system