KEGG   Populus trichocarpa (black cottonwood): POPTR_0004s13540gHelp
Entry
POPTR_0004s13540g CDS       T01077                                 

Gene name
POPTRDRAFT_800674
Definition
(RefSeq) hypothetical protein
  KO
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
Enzymes [BR:pop01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     POPTR_0004s13540g (POPTRDRAFT_800674)
Peptidases [BR:pop01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   POPTR_0004s13540g (POPTRDRAFT_800674)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LGIV
AA seq 334 aa AA seqDB search
MSWCTIESDPGVFTELIQQMHVKGVQVEELYSLDLDSLDSLRPVYGLVFLFKWRPEEKDE
RVVITDPNPNLFFARQVINNACASQAILSILMNCPDMDIGPELSKLKEFTKNFPPELKGL
AINNCEAIRAAHNSFARLGPFVPEEQKAASKEDDVYHFISYLPVDGVLYELDGLKEGPIS
LGQCTGGHGDMDWLLMVQPVIQERIERHSNSEIRFNLLAIVKNRKEMYTAELKELQKRRE
RIVQQLAAFQAERLVDNGNYESLNKSLSEVNAAIESATEKILMEEEKFKKWRTENIRRKH
NYIPFLFNFLKILAEKKQLKPLIEKAKQKTSASK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggtgcactattgagtctgatccaggtgtgttcacggaacttatacaacaaatg
catgtaaaaggtgtacaggttgaagagttgtattcattggaccttgattctcttgacagc
ctgagacctgtatatgggttggtttttcttttcaaatggcgcccagaagagaaagatgaa
cgtgttgtaattacggatccaaatcctaatctcttttttgcccgtcaggttattaacaat
gcttgtgcaagtcaagcaattttgtctatcctcatgaactgcccagatatggacattggt
ccagaattgtcgaaattaaaagaattcaccaagaattttcctcctgagctcaaagggttg
gctattaataactgcgaagctatacgtgcagcccataacagttttgcacgacttgggcct
ttcgttcctgaagagcagaaggcagccagcaaagaagatgacgtgtaccattttataagt
tacttgcctgttgatggagtgctatatgaacttgatggattgaaagagggacccatcagc
cttggtcagtgcactggtgggcatggtgatatggactggctgcttatggtgcagccagtg
atccaggaacgcatagaaaggcattccaatagtgagataagatttaatctcttggcaata
gtcaaaaacaggaaagaaatgtatactgctgaactcaaggagctccaaaagaggagggag
cgtatcgtgcagcagctagctgctttccaggcagaaagactggtcgacaatggcaactat
gaatccctgaacaaatccctgtctgaagtgaatgctgcgattgaaagtgctacagaaaag
attttgatggaggaagaaaaattcaagaaatggagaacagaaaatatccgtaggaagcac
aattatattccgtttttgttcaacttcctcaagattcttgctgaaaagaagcaactgaag
ccccttatagagaaggccaagcaaaaaaccagcgcctccaagtaa

DBGET integrated database retrieval system