KEGG   Populus trichocarpa (black cottonwood): POPTR_0005s16280gHelp
Entry
POPTR_0005s16280g CDS       T01077                                 

Gene name
POPTRDRAFT_559176
Definition
histone acetyltransferase family protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
Enzymes [BR:pop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     POPTR_0005s16280g (POPTRDRAFT_559176)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 448 aa AA seqDB search
MGSIDTPKNPENGSTTLPPTTDASATYDGDQNPTNGMPPRVTEMTLPVESEVVKKRKTSM
LPLEVGTRVLCRWRDCKYHPVKVIERRKMQSGGTNDYEYYVHYTEFNRRLDEWVKLEQLD
LDSVETVVDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATI
ELGRYEIETWYFSPFPPEYNDCLQLYFCEFCLNFMKRKEQLQRHMKKCDLKHPPGDEIYR
SGTLSMFEIDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYF
SKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYR
GYWTRVLLDILKRHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVICADPKVL
DRHLKAAGRGGLEVDVSKLIWTPYKEQG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgggttcgattgacacccccaaaaatccagagaacggctccacaactctgcctcccacc
accgacgcttccgctacctacgacggcgatcaaaaccctactaacggaatgcctccacgt
gtcaccgaaatgacgcttccggtcgaatccgaagtggttaagaagaggaaaacgagtatg
ttaccgctcgaggtaggcactcgcgttttgtgccgttggagagactgcaaataccatccg
gttaaggtcatcgagcgccgtaagatgcagtctggtgggaccaacgattacgagtattac
gtgcattatacagagttcaataggaggcttgatgagtgggtgaaacttgaacaactagat
cttgattcagtagagactgttgttgatgaaaaggtggaggacaaggtaacaagcttgaaa
atgacacgccaccagaaacggaagattgacgagacacatgtggagggccatgaggagctt
gatgctgccagcttacgtgagcatgaggaattcacaaaagtaaaaaatatagccacgatt
gagcttggaagatatgagattgagacatggtacttctcgcctttcccaccagaatacaat
gattgtctgcagctgtacttttgtgaattttgcctcaatttcatgaagcgtaaagagcag
ctccaaaggcatatgaagaagtgtgatctcaagcacccgcctggtgatgaaatttatcga
agtggcacgttatcaatgtttgagatagatggcaaaaagaacaaggtttatgggcagaat
ctttgttatttggcgaagttgtttcttgatcacaagaccctttattatgatgttgaccta
tttctattttacgttttgtgcgaatgtgacgatcgaggatgccacatggttggatatttt
tccaaggaaaagcattctgaggaatcctataatttggcatgtatcctcacccttcctcct
tatcaaaggaaaggctatggaaagttcttaattgccttctcatatgaactttccaagaaa
gaaggtaaagttggcacacctgaaagacccctttctgacctggggttgttgagctacaga
ggatattggacccgagttcttttagacatcttgaaaaggcacaagggcaatatttctatc
aaggagcttagtgacatgacagcaataaaggcagaggatattttgactacccttcagagc
ctagaactgattcagtacaggaaagggcagcatgtgatatgtgcggatccgaaggtcctg
gatcgtcatctaaaagctgctggtcggggtggtcttgaggttgatgttagcaaattgatc
tggactccttacaaagaacaaggttga

DBGET integrated database retrieval system