KEGG   Populus trichocarpa (black cottonwood): POPTR_0005s23890gHelp
Entry
POPTR_0005s23890g CDS       T01077                                 

Gene name
POPTRDRAFT_559629
Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
Enzymes [BR:pop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     POPTR_0005s23890g (POPTRDRAFT_559629)
Transcription machinery [BR:pop03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     POPTR_0005s23890g (POPTRDRAFT_559629)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 564 aa AA seqDB search
MDTHSHLTAPNRSRSSQSPSPSHSASASASASATSSIHKRKLAAAAAAYDDHLPPFAPSS
LSADTRDGALTSNDDLESISARGADSDSDDAEDSDTVLDDDEEDFDNDSSMRTFTTARLE
TTNAAGSSSRNTKIKMENTNVKIENSDSGKDGGHTGTGAVGPAAAGSSGPGIVVKEDSVK
IFTENLQASGAYSAREESLKREEEAGKLKFVCYSNDDVDEHMVWLIGLKNIFARQLPNMP
KEYIVRLVMDRSHKSVMIIRRNQVVGGITYRPYVSQRFGEIAFCAITADEQVKGYGTRLM
NHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECK
IDQKLPYTDLSTMIRRQRQAIDEKIRELSNCHIIYPGIDFQKKEAGIPKKIIKVEDIPGL
REAGWTLDQWGHSRFRTLNTATDSATNQKHLTAFMRSLLKATQLNVKQSMHDHVDAWPFK
EPVDARDVPDYYDIIKDPMDLKTMSKRVESEQYYVTLEMFIADVKRMCANARTYNSPDTI
YYKLEAHFQSKVQSGIQSGTKILP
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggacactcactctcacttaactgcacctaatcgctctcgcagctctcaatctccgtct
ccttcgcactcggcctcggcctcggcctccgcctctgcaacctcttccatccacaaacgg
aaactcgccgcggctgcggcggcgtacgacgaccacttgccaccatttgctccgtcttct
ctgtccgcagacactcgcgacggcgctctcacctccaacgacgaccttgagagcatctcc
gctcgcggcgccgactctgactccgatgacgctgaagattccgacaccgtcctcgacgat
gacgaggaagacttcgacaacgattcctccatgagaacgttcaccacagcccgcctcgag
accactaacgccgctggcagcagcagccggaacacgaagatcaaaatggagaacacgaat
gtcaagattgaaaattctgatagcgggaaggacggtgggcacacagggactggtgcagtg
gggcctgctgcagcggggagttctgggccagggattgtggtgaaggaggattctgttaaa
atatttacggaaaatttgcaggctagtggagcttatagcgcgagagaagagagtttgaag
agagaggaggaagcaggaaaactcaagtttgtgtgttattcaaatgatgatgttgatgag
catatggtttggctgataggattgaagaatatatttgcgaggcagttgcctaacatgccc
aaggagtacatagttcgacttgtgatggatagaagccacaaatctgtgatgattattaga
cgcaatcaggtggttggtggtatcacttatcgtccatatgtcagtcagaggtttggggag
atagctttttgtgcaatcaccgcagatgaacaagtaaaaggttatggcacgagattgatg
aatcacttaaagcagcatgcacgtgatgttgatgggttaacacattttctgacgtatgct
gacaataatgctgttggttattttatcaagcagggtttcacaaaagagatttacttggag
aaagatcgatggcaagggtatattaaagactatgatggaggtatcttaatggaatgcaag
attgatcaaaaacttccttacactgacttatcaaccatgattcgtcgtcagagacaggca
attgatgaaaagataagagagctatccaattgtcatatcatctatcctggaattgatttt
caaaagaaagaagctggtattcccaagaaaatcatcaaagtcgaggatattcctggcttg
agggaggctgggtggactcttgatcaatggggccattcacgtttcagaacattaaacact
gctacggatagtgccacaaatcaaaaacatttgactgcatttatgcgctcacttttaaag
gcaactcaactcaatgtgaagcagtcaatgcatgaccatgtggatgcttggccatttaag
gaaccagttgatgctcgtgatgtccctgattattatgacatcatcaaggatcccatggat
ctgaagacgatgtcaaaaagggtagagtcagaacaatactatgtaacacttgagatgttc
attgctgatgttaagaggatgtgtgccaatgcacggacatacaactcacctgataccatt
tattataagctggaagcccattttcaaagcaaggttcagtcaggcatccaatctggtaca
aaaattctgccatga

DBGET integrated database retrieval system