KEGG   Populus trichocarpa (black cottonwood): POPTR_0005s28090gHelp
Entry
POPTR_0005s28090g CDS       T01077                                 

Gene name
POPTRDRAFT_715748
Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pop00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    POPTR_0005s28090g (POPTRDRAFT_715748)
Enzymes [BR:pop01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     POPTR_0005s28090g (POPTRDRAFT_715748)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LGV
AA seq 463 aa AA seqDB search
MGKRSRWLWWMVVAVGVVGVVATGTKSGAGEGEGKGKVLEPLVTRIAFGSCANQSAPQPI
WNAIIDFDPQVFIWLGDNVYGDTKRPFKLFGKERTIGPWKNAPRFIPSSPKELESRYQKA
KSNPGYSRLRHTTQVIGTWDDHDYGLNDAGKEFGGKITNQKLLLDFLDEPQDSPRRNQEG
VYTSYMFGPVGRQIKVILLDTRYHRDPLRSDGSVLGSSQWTWLEKELNGPKSAITIIGSS
VQVISNLSATTRPLFSLESWGRFPKERDRLFKLIADTKREGVFFISGDVHFGEISRYDCA
TGYPLYDVTASGLTQAVEKAVPHVFSLIVRFVAWLTPTTMRVISTNCRFKSCTYGQPNFG
AIEIDWSTTPVTLKLEVRDIVGYPVTGVKFPLVELQSRGSVPSVKAGEHRRHCSLEVNLP
WMIKYRLAILFYCSVSALLLAMIGLAYAATLAFRLFLHKCKLD
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaggagtcggtggttgtggtggatggtggtggctgtaggtgtagtaggagtg
gtggcgacaggcacaaagagcggcgcgggggaaggggaaggaaaagggaaagtgttagag
cctctcgtcaccagaattgcctttggatcctgcgccaaccaaagcgctcctcagcccatt
tggaatgccataattgactttgatccccaagtttttatttggctgggagacaacgtttat
ggagacactaaacgtccttttaagttatttggaaaggaaaggactattgggccttggaag
aatgctcctaggtttatcccttcctccccaaaggaattggaatccagataccagaaagct
aagagtaatcccggttattctcgtcttcgacacactacacaggttattggtacctgggat
gaccatgactatggattaaatgatgctggaaaagagtttggtggtaaaatcactaaccaa
aagcttctcctcgatttcttagacgagcctcaagacagtcctcggcgcaaccaggagggt
gtatatacttcatatatgtttggcccagtgggcagacaaatcaaggtcatccttttagac
acgaggtaccacagagaccctttgcgcagcgatggaagtgtcctgggaagttctcagtgg
acatggttagaaaaggagttgaacggaccgaaatcagccattaccatcattgggtcttca
gtgcaggttatatcaaatctttcagcaaccactcgcccattgttttctttggagtcctgg
ggacgtttcccaaaggaaagggatcgtcttttcaaattgatagcagatactaagagagaa
ggtgtcttcttcatcagtggagatgttcattttggagaaatttctagatatgactgtgct
actggatatccactatatgatgttactgcaagtgggcttacacaagctgttgagaaagcg
gtcccacatgtatttagtttgatagtgagatttgtggcatggctgacaccaacgacaatg
agagtgatcagcacaaattgcagattcaagtcatgcacgtatggtcagccaaattttgga
gcaattgaaattgactggagcacaaccccagtaaccttgaaacttgaggtcagggacatc
gtagggtaccccgtcactggtgtaaaatttccattagtggaattgcaatcacgtggctca
gtgccatcagttaaagcaggggaacatcgaaggcattgctcccttgaagttaatctgcca
tggatgatcaaatatcgcctggcaattttattctactgttctgtatctgcattgcttctt
gctatgattgggctggcttatgcagccacattagccttcagactgttcctccacaaatgc
aagctagattga

DBGET integrated database retrieval system