KEGG   Populus trichocarpa (black cottonwood): POPTR_0008s17420gHelp
Entry
POPTR_0008s17420g CDS       T01077                                 

Gene name
POPTRDRAFT_832848
Definition
beta-amylase family protein
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pop00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    POPTR_0008s17420g (POPTRDRAFT_832848)
Enzymes [BR:pop01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     POPTR_0008s17420g (POPTRDRAFT_832848)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LGVIII
AA seq 562 aa AA seqDB search
MNITHQIGALAGTPIQAESITNTETTATASAAAQKSQPTSPCRSPILSAGNGIRPDLSVA
CRAFATETMDLVSFDETTEQEKTYKEVNTVKEKGVPVYVMMPLDSVTMSNTLNRRKAMNA
SLQALKSAGVEGVMMDVWWGLVERDTPGVYNWGGYTELLEMAKRHGLKVQAVMSFHQCGG
NVGDSCTVPLPKWVVEEVHKDQDLAYTDQWGRRNYEYVSLGCDSIPVLKGRTPVQCYSDF
MRAFRDNFKHLLGDTIVEIQVGMGPAGELRYPSYPEQNGTWRFPGIGAFQCYDKYMLSSL
KAAAEAAGKPEWGSTGPTDAGEYNNWPEDTRFFRKEGGGWTCPYGEFFLSWYSQMLLDHA
ERILSSAKAIYENTGVKISVKIAGIHWHYGTRSHAPELTAGYYNTRNRDGYLPIAQMLAR
YGAIFNFTCIEMRDHEQPQDALCAPEKLVRQVALATREAEVPLAGENALPRYDENAHEQI
LQASSLNIDGNSKDSEMCAFTYLRMNPHLFQPDNWRRFVGFVKKMNEVKSPDRCLEQVER
EAEHFVHVSRPLVKEAAVAHMH
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaacataacacatcagatcggagctttagccggaacaccaatccaagcagaatcaata
accaacactgaaaccaccgcaacagccagcgcagcggcgcaaaaatcacaaccaacaagc
ccttgtaggtctccaatactaagcgccggcaacggcatccgtccggatctatcagtggca
tgccgagcattcgcaacagaaacaatggacttggtgagttttgacgagacaacagaacaa
gagaagacgtataaagaggtgaacacggtgaaggagaaaggagtgccagtttacgtgatg
atgccgttggatagtgtgacgatgagtaacacgttgaatagaaggaaagcgatgaatgca
agtttacaggcgttgaagagcgcaggcgtggaaggggtgatgatggatgtctggtgggga
ttagtggagagagatacgcctggtgtgtataattggggagggtataccgaactcttagaa
atggctaaacgacatggtcttaaggttcaggctgtgatgtcgtttcatcagtgtggcggc
aacgttggtgattcttgcacggttccattgccaaagtgggttgtggaggaggttcataaa
gatcaagaccttgcatacactgatcagtgggggaggaggaattatgagtatgtatcactt
gggtgcgatagcattccagttctcaaggggaggacacctgtgcaatgttactctgatttt
atgcgggcctttagggacaacttcaaacaccttcttggtgacaccattgtggaaatccaa
gtgggaatgggtccagcaggtgagctccgctatccttcgtacccggagcagaatggaact
tggagatttcctggaatcggagccttccaatgttacgataagtatatgttgagtagcttg
aaagcagcggcggaagctgctggtaagccagaatggggtagcacaggcccaactgatgct
ggtgagtacaacaactggccggaagacacccggtttttcagaaaagaaggtggtggctgg
acttgtccctatggtgaattcttcctctcttggtactcgcagatgctcttagaccacgct
gagagaatattgtcgtcagcgaaggctatctatgagaatactggtgtaaagatctcagtg
aagattgcaggaattcattggcactatggaacccggtctcatgccccagagctcacagca
ggatattataacacgagaaacagagatggttaccttcctattgctcaaatgttagctcgg
tatggtgctatattcaatttcacttgcatagaaatgcgtgaccatgaacagccacaggat
gccctttgtgcccctgagaagcttgtgaggcaagtggctttagcaacgcgagaagcagag
gttcctcttgccggggaaaatgcactgccacgatatgatgagaacgcacatgagcaaatt
ttgcaggcgtcatcattgaatattgatggaaactcaaaagacagcgagatgtgtgctttt
acgtacttgagaatgaaccctcacttatttcaaccagataactggagacgcttcgtggga
tttgtgaagaagatgaatgaagtgaagagtcctgaccggtgtttggagcaggttgagagg
gaagcggagcattttgtgcatgtaagtcgacctttagtaaaggaggcggctgtggctcat
atgcactag

DBGET integrated database retrieval system