KEGG   Populus trichocarpa (black cottonwood): POPTR_0009s12810gHelp
Entry
POPTR_0009s12810g CDS       T01077                                 

Gene name
POPTRDRAFT_557164
Definition
3-oxo-5-alpha-steroid 4-dehydrogenase family protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
Enzymes [BR:pop01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     POPTR_0009s12810g (POPTRDRAFT_557164)
    1.3.1.94  polyprenol reductase
     POPTR_0009s12810g (POPTRDRAFT_557164)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LGIX
AA seq 339 aa AA seqDB search
MELGLVELLRAAWIAGTLPILIASLPCSWLGSFHGLVLGFARRGKIMQSSSHRKFTVPQR
FFTHFYVVAVAWTTLLLLGTSIYAYRMTPIVSEPFFYSDLGSYLAGRSNIFSFHRSRLMS
LENRYRVWHSVFLLLLMEVQVSRRLFETAYVFNYSASARMHIFGYLTGLFFYTAAPLTLC
CTCAPEVLKFGINEVSEFILKGTSSMQNIEFHWWDFVNPLLKLGWCQWIGAVIFLWGWIH
QHRCHAILGSLREHVGKADEYVIPRGDWFEIVSSPHYLAEIVIYAGMVFASGGADLTIWL
VFGFVVSNLVFAAAETHRWYLQKFDNYPSNRVAIIPFLC
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggaacttgggcttgtggagttgttgagagcagcttggattgcagggacactgcctata
cttatagcttcactgccatgttcttggctgggttcttttcatggacttgttttggggttt
gcaaggagaggaaagatcatgcaatcatcatctcatcgtaaattcactgttccccaaaga
ttctttactcatttctatgtggtggctgtggcgtggacaactctcttgcttcttggaaca
tcgatatatgcttatagaatgacaccaatagtttctgagccgtttttctactctgatctt
ggcagctacttggcaggacgatcaaacatattctcatttcatcgatcacggttgatgagt
ttagagaatagatacagggtttggcattctgtgtttctgcttttgctaatggaagttcaa
gtctcgaggcgtcttttcgagacagcatatgtatttaattatagcgcctctgctcggatg
cacatttttggctatcttactggcttattcttctacacagcagcgcctctgacactctgc
tgtacctgtgcacccgaagtactcaaatttggcataaatgaagtgtctgagttcattctt
aaaggcacaagctcaatgcaaaacattgaatttcactggtgggactttgttaacccttta
ttgaagcttggatggtgccagtggattggcgcagttatatttctttggggttggattcat
cagcatcgttgccatgcaattcttggctcactaagggaacacgtgggaaaggctgatgaa
tatgtaattccccgtggtgattggttcgagattgtttcatctccacactatttggcagag
attgttatatatgctggcatggtttttgctagtggaggggcagacctcaccatttggtta
gtttttggatttgtggtgtcaaatctggtgtttgcagctgcagaaacacacaggtggtat
cttcagaaatttgacaattatccaagcaaccgtgttgcaattattccatttttatgttaa

DBGET integrated database retrieval system