KEGG   Populus trichocarpa (black cottonwood): POPTR_0009s15880gHelp
Entry
POPTR_0009s15880g CDS       T01077                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pop00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    POPTR_0009s15880g
Enzymes [BR:pop01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     POPTR_0009s15880g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LGIX
AA seq 278 aa AA seqDB search
MESLQSHRVEMISIAVALVAIGAGTAFYFYITKKPKGCLDPENFKEYKLVKRTELSHNVA
KFKFALPTPNSVLGLPIGQHMSCRGQDSVGEEVVKPYTPTTLDSDIGYFELVIKMYPQGR
MSHHFREMREGDYLAVKGPKGRFKYQPNQVRAFGMIAGGTGITPMFQVTRAILENPDDKT
KIHLIYANVTYEDILLKEEIDNLAIIFPNQFNVHYVLNQPPEGWEGGIGFISKEMIQSHC
PPPSPDVQILRCGPPPMNKAMAAHLNDLGYTAQMQFQF
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtttacagtctcatagagtggaaatgataagcattgctgtggctcttgttgcc
attggtgctggcactgctttttatttctacatcaccaagaagcctaaaggttgcttggac
cctgaaaatttcaaggaatataaacttgttaagagaaccgaactgagtcataatgtggcc
aagtttaaatttgctcttcccacaccgaattcagttttgggactgccaattggacaacat
atgagttgcaggggacaggatagtgtcggtgaagaagttgtcaagccgtataccccaaca
acgttggattctgatattggatactttgaactagttataaagatgtatccacaaggtagg
atgtcccaccacttccgtgaaatgcgtgaaggtgattacttggccgtgaaggggcctaag
ggtcgtttcaagtatcaacctaaccaagtcagagcatttggaatgattgctgggggcact
ggaattactcccatgttccaggtaactagagccatattagaaaacccagatgacaaaaca
aaaatacatcttatttatgccaatgtcacatatgaggacattcttttgaaggaagagatt
gataatctggcaatcatttttcctaaccaatttaacgtccactatgttctgaatcagcct
ccagaaggatgggagggtggcatcgggttcatatccaaggaaatgattcaatcccactgc
ccgccaccttcacctgatgttcagattttgaggtgtggacctccaccaatgaacaaggcc
atggcagcccaccttaatgatcttggatatactgctcaaatgcagttccagttttga

DBGET integrated database retrieval system