KEGG   Populus trichocarpa (black cottonwood): POPTR_0010s25970gHelp
Entry
POPTR_0010s25970g CDS       T01077                                 

Gene name
POPTRDRAFT_833904
Definition
putative delta-7-sterol reductase family protein
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pop00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    POPTR_0010s25970g (POPTRDRAFT_833904)
Enzymes [BR:pop01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     POPTR_0010s25970g (POPTRDRAFT_833904)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 434 aa AA seqDB search
MAETKTVHSPLVTYFSMLSLLTLCPPFVILLWYTMVHADGSVCQTWDYLKQHGLQGFINI
WPRPTAIAWKIIACYAAFEAALQLLLPGKKVEGPISPEGNRPVYKANGVAAYVVTLVTYL
SLWWFGIFNPSIVYDNLGEIFSALIFGSLVFCVFLYIKGHLAPSSTDSGSSGNMIIDFYW
GLELYPRIGKNFDIKVFTNCRFGMMSWAVLALTYCIKQYEQNGKVADSMLVNTILMLVYV
TKFFWWEAGYWNTMDIAHDRAGFYICWGCLVWVPSVYTSPGMYLVNHPVNLGLQLALYIL
AAGILSIYVNYDCDRQRQEFRRTNGKCLVWGRAPSKIVASYTTTSGQTKISLLLTSGWWG
LSRHFHYVPEILAAFFWTVPALFNHFLPYFYVIFLTILLFDRAKRDDDRCRSKYGKYWKL
YCEKVRYRIVPGIY
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaacgaagactgtgcattcgccgctggttacttatttttcaatgctttcactt
ctcactctctgccctccttttgttattctactatggtatacaatggtacatgctgatggg
tcagtttgtcaaacttgggattacttgaagcaacatggcttgcaaggatttataaacatt
tggccaaggcctactgcaattgcctggaaaattattgcttgttatgcagcatttgaggct
gcactgcagcttcttttacctggaaaaaaggtcgagggtccaatctctcctgaaggaaac
cgacctgtttacaaggcaaatggtgtggcagcatatgtggtgactttagttacctatctt
agcctttggtggtttggtatattcaacccctcgattgtttatgataatttgggagaaata
ttttctgctctcatttttggaagcttagtcttctgtgttttcttatacataaagggtcat
ttggctccatcatctactgattctggatcatctgggaacatgataattgacttctattgg
ggtttggagctgtatcctcgaataggaaagaacttcgacatcaaagttttcacaaactgc
agatttgggatgatgtcttgggctgttctggcattaacctattgcattaagcagtatgag
cagaatgggaaagtagctgactccatgcttgtaaatacaatattgatgctggtgtacgtc
acaaagtttttttggtgggaagctggttactggaacacaatggacattgcacatgatcga
gctggattttatatttgctggggatgcttggtatgggttccatctgtgtatacttctccc
ggcatgtaccttgtaaaccatcctgtgaaccttggacttcagcttgcactctatatacta
gcagcaggcattctctccatatatgtcaattatgattgtgacaggcaaaggcaagaattt
cgcagaacaaatggcaaatgtttggtctggggaagggctccatcaaagattgtggcctca
tacactacaacatctgggcaaacaaagataagcctccttttgacatcgggatggtggggc
ttatctcgtcatttccattatgtacctgaaatactggctgcttttttctggactgtcccg
gctctttttaatcatttcttaccctatttctatgtgatatttctgaccatccttctgttt
gaccgagctaaaagggatgatgatcgatgtcggtccaagtatgggaagtactggaagttg
tactgtgagaaggttcgctacaggattgttcctggaatctactaa

DBGET integrated database retrieval system