KEGG   Populus trichocarpa (black cottonwood): POPTR_0011s11460gHelp
Entry
POPTR_0011s11460g CDS       T01077                                 

Gene name
POPTRDRAFT_1094210
Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pop00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    POPTR_0011s11460g (POPTRDRAFT_1094210)
Enzymes [BR:pop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     POPTR_0011s11460g (POPTRDRAFT_1094210)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 376 aa AA seqDB search
MKAVSFSPANHCNLKLQKYPIKQPTLANPIHFNNHQNQKPSNKKHHFPSFSIKASKTPQT
PLTKYPNTPPLVVVGSANADIYVEIDRLPAEGETISAKTGQTLAGGKGANQAACGAKLSY
PTYFVGQVGEDAHGKLITEALKNGGVNLDCVRNLSDVPTGHAVVMLQPDGQNSIIIVGGA
NMSCWPEKLSDEDLEVVRKAGVVLLQREIPDLVNIQVAKAAKSAGVPVILDAGGMDAPMP
PELLNVVDIFSPNESELARLTCMSTESFEQIGQAVVKCHKMGVKQVLVKLGAKGSALFIE
GEKPIKQTIISAARVLDTTGAGDTFTAAFAVALVEGKTKEECMRFAAAAASLCVQVKGAI
PSMPDRTSVLHLLQTV
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtgtcattttcaccagcaaatcattgcaaccttaaactccaaaagtatccc
ataaaacaaccaacacttgcaaacccaattcacttcaacaatcaccaaaaccagaagcca
tccaacaaaaaacaccactttccttcattttccatcaaagcctcaaaaacccctcaaacc
ccgttaaccaaatatcccaatacaccaccactagtagttgttggctcagccaatgcagat
atatatgtggagattgatagattaccagcagaaggggagaccatctcagccaagactggg
cagactcttgctggtggcaaaggagctaaccaggccgcatgtggtgcaaaactttcatat
ccaacatactttgtggggcaagttggcgaggatgcacatgggaagttgatcactgaggct
ttaaagaatggtggggttaatcttgattgtgtgaggaatctgagtgatgtgcctactgga
catgctgtggtgatgctgcagcctgatgggcaaaattctattattattgttggtggagct
aacatgagttgctggcctgagaagctcagcgatgaggatttggaggttgtgaggaaggct
ggggttgttttgcttcaaagggaaatacctgatttagttaatattcaagtggcaaaggct
gcaaaaagcgctggtgttcctgttattttggatgctgggggaatggatgcaccaatgccc
cctgaattgttgaatgttgttgacatcttcagcccgaatgaaagtgaacttgcacgtttg
acttgcatgtcaactgaaagctttgaacagattggtcaggctgtcgttaagtgtcataaa
atgggagtaaagcaagttctggtgaagcttggggctaaagggtctgctttattcatagaa
ggggaaaaaccaattaaacaaaccataatttctgctgcaagagtcctagacactactgga
gctggagatacctttactgctgcttttgctgtggcactcgtggagggcaaaacaaaggag
gaatgcatgagatttgctgctgcagcagcttctctctgtgttcaagtgaagggagccatc
cctagcatgcctgaccggacatcagttttacatctactccaaactgtctga

DBGET integrated database retrieval system