KEGG   Populus trichocarpa (black cottonwood): POPTR_0011s15490gHelp
Entry
POPTR_0011s15490g CDS       T01077                                 

Gene name
POPTRDRAFT_1094798
Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pop00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    POPTR_0011s15490g (POPTRDRAFT_1094798)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    POPTR_0011s15490g (POPTRDRAFT_1094798)
Enzymes [BR:pop01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     POPTR_0011s15490g (POPTRDRAFT_1094798)
Lipid biosynthesis proteins [BR:pop01004]
 Desaturase
  First
   POPTR_0011s15490g (POPTRDRAFT_1094798)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LGXI
AA seq 386 aa AA seqDB search
MALMTSPLTKSKPCLFLPFTHAKKLGSPPAILLNYGHYNPKFLPLTTNKCKKEKLSSLLD
ASNKNYSSTKKALQVVADAGNAPLSEAEPRNLGKIFLSDVVVRRRRQVFWGRKWNSSDIV
NAGVISAVHFLSLFGPFYFTWPAFWVALGIGIVTGLLGITLSFHRNLSHRSFKLPKWLEY
FFAYCGVQALQRDPIFWVSTHRHHHQFCDSERDPHSPTEGFWFSHITWLFDNNYITEKCG
GQNNVGDLEKQPFYKFMQNTYFLHPIALGVLLYAVGGFPFLVWGMGVRTALALHITWLIN
SASHLWGKRAWNTGDLSRNNWWLALLTFGEGWHNNHHAFEYSARHGLEWWQIDMTWYVVR
FLQAIGLATDVKLPSEVQKQRMAFNN
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggctttgatgacatctccattaaccaaatccaaaccttgcctttttctgccttttacc
catgctaagaaactgggttctccacctgctatactcctaaattatggtcactataacccc
aagttcctaccactaacaaccaacaaatgcaaaaaagaaaaattatcaagtcttttggat
gcttcaaataagaattatagcagtacaaaaaaagcactacaagtagtggctgatgctggt
aatgcacctctatcagaggccgagcctaggaacctcgggaaaatctttctgtcagatgtg
gtggtgaggagaagaaggcaggtattttggggcaggaaatggaattcatcagatatagtc
aatgctggtgtaatttcggcggtgcattttctatctttgtttggacctttttatttcact
tggcctgcattttgggttgcccttggcatcggtattgtcactggacttctaggtatcact
ctttctttccataggaatctttctcataggagtttcaagcttccaaaatggctcgagtat
ttttttgcatactgtggggttcaagctcttcaaagggatcctattttttgggttagcact
catagacaccaccaccagttttgtgattctgagagagacccgcatagccctactgaaggg
ttttggtttagtcacatcacttggctctttgacaataattatattactgaaaagtgtgga
gggcaaaacaatgttggggatttagagaagcaacccttttacaagttcatgcaaaacacg
tactttctacatccaattgcgcttggagttctgctatatgcagtgggaggatttcccttc
cttgtatggggaatgggtgtgagaaccgcactggctttgcacatcacttggctaataaac
tcagcttctcatttatggggaaagcgagcgtggaacaccggcgacttgtctaggaacaat
tggtggcttgcgttgcttacttttggagaaggttggcataataatcaccatgcttttgaa
tactcagccagacatggcctggaatggtggcagattgacatgacttggtatgttgtaagg
tttcttcaagctattggactggcaacagatgtgaagctgccatcggaagttcaaaagcaa
aggatggctttcaacaattga

DBGET integrated database retrieval system