KEGG   Populus trichocarpa (black cottonwood): POPTR_0013s13810gHelp
Entry
POPTR_0013s13810g CDS       T01077                                 

Gene name
POPTRDRAFT_774012
Definition
hypothetical protein
Orthology
K09591  
steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Brassinosteroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Castasterone biosynthesis, campesterol => castasterone
Brite
KEGG Orthology (KO) [BR:pop00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    POPTR_0013s13810g (POPTRDRAFT_774012)
Enzymes [BR:pop01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     POPTR_0013s13810g (POPTRDRAFT_774012)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 264 aa AA seqDB search
MALLDQSFFHYSLLAYYLLGLPTFIALRFFQFPYGKHNRLGWGPTIPPPLAWFIMESPSI
LLPLILFPLGQHFTNPKALVLMSPYLLHYFHRTFIYPLRIYQSTSQQNTKTTIGFPLILA
FNGFLTQALNTYIQARWVSHYKSDYDSDGGLFWWKFFGGLVVFLWGMRINMWADTALLVL
KRESGGYKVPRGGWFELVTCPNYFGEIVEWLGWAVMTWSWAGFGFFLYTCSNLVPRACAN
HKWYLQKFGEDYPKNRKAVIPFLV
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggccttgttagaccagagtttctttcattacagcctcctagcttactacctcctagga
ctccctaccttcattgccctaaggttctttcaattcccatatggcaagcacaaccgtcta
ggatggggccctacaattcctccacctttggcttggtttatcatggaaagcccctccatt
ttgctccccctcatcctctttcccttgggccaacacttcacaaatcccaaagctctagtt
ctcatgtctccttatctcctccactacttccaccgcactttcatctacccgcttcgcatt
taccagagtacctctcaacagaataccaaaaccactattggtttcccgttgattttggcc
tttaacggatttttgactcaagcattgaatacttacatacaggctaggtgggtttctcat
tataaaagtgattatgatagtgatggaggtttgttttggtggaaattctttggtggattg
gtggtttttctatggggcatgaggattaatatgtgggctgatacggctttgctggttttg
aagagggaaagtggtggatataaggtgccaagaggagggtggtttgagctggtaacttgt
cctaactactttggagagattgtggagtggcttggatgggcagtgatgacttggtcatgg
gctgggtttggttttttcctctacacatgttctaacttggtgcctagggcatgtgccaat
cacaaatggtatttgcagaagtttggagaggattatcccaagaatagaaaagcagtgatc
cctttcctcgtttaa

DBGET integrated database retrieval system