KEGG   Populus trichocarpa (black cottonwood): POPTR_0014s02940gHelp
Entry
POPTR_0014s02940g CDS       T01077                                 

Definition
alpha amylase family protein
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pop00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    POPTR_0014s02940g
Enzymes [BR:pop01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     POPTR_0014s02940g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LGXIV
AA seq 423 aa AA seqDB search
MSFLTFCFFSLFLSVFPLLTSSYLLFQGFNWESCNKAGGWYNSLKNSVPDLANAGITHVW
LPPSSQSVAPQGRYMPGRLYDLSASRYGSQDELKSLIGDFNQKGIKCLADIVINHRTAEK
QDERGIWSVFEGGTSDGRLDWGPSFICGDDTAYSDGKGNPDSGDDFEPAPDIDHLNPRVQ
RELSDWMNWLKSEIGFDGWRFDFVKGYAPSVTKIYMENTSPDFAVGEKWDSLAYGQDGKL
DYNQDAHRGSIKDWIQAAGGAVTAFDFTSKGILQAAVQGELWRLKDSNGKPPGLIGLLPQ
NAVTFIDNHDTGSTQQIWPFPSDKVMQGYAYILTHPGTPSIFYDHFFDWGLKEEIGKLAT
IRKNYGIGSASTVNILASDADLYVAAINDNIIMKIGPKTDLGNLIPSNFQVATSGTDYCV
WVK
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgagctttctcactttctgcttcttctctctctttctctcagttttccctctgctcact
tcttcttatttactatttcaggggttcaattgggagtcatgtaacaaggcaggaggatgg
tacaactcgctaaaaaactcagttcctgatttggctaatgccggaattactcatgtctgg
cttcctccatcctctcagtccgttgcaccacaaggtagatatatgccaggcaggctttat
gatctgagcgcatcaagatatggatcacaggatgaattgaaatcactaattggggatttc
aaccagaagggaattaaatgcctagctgacattgtcataaaccatagaactgctgagaag
caagatgagagaggaatatggtctgtttttgaaggtggaacttctgatggtcgccttgac
tgggggccatccttcatttgtggcgatgacactgcctattctgatggcaaaggaaatcct
gattcaggagatgactttgagcctgcccctgatattgaccacctcaatccaagagttcag
agagaattatcagattggatgaattggttaaagtctgaaataggatttgatggatggcga
ttcgactttgttaagggttacgctcctagtgttaccaaaatttacatggaaaatacttca
ccagattttgcagttggtgaaaaatgggactctcttgcttatggtcaggatggaaagctt
gattataaccaggatgcgcaccgcggcagtataaaagattggattcaagcagctggtggt
gctgtcacagcatttgatttcacatctaaagggatacttcaagctgctgtgcaaggagag
ttatggaggttgaaggactcaaatggaaagccaccaggattgataggcctgttgccacaa
aatgctgtgactttcattgacaatcatgacaccgggtctactcagcagatttggccattt
ccatcagataaagtcatgcagggatatgcctacattcttacccatccagggaccccgtcc
atcttttatgatcacttctttgactggggcctcaaggaagaaattgggaaattggcaaca
attaggaaaaattacgggattggctctgccagcactgtgaatattttagcctctgatgct
gatctttatgtggcagcaattaatgataacataatcatgaagattggacccaaaaccgat
ctcggaaaccttatcccctcaaacttccaggttgctacatctggaacagattactgtgtg
tgggtaaaatag

DBGET integrated database retrieval system