KEGG   Populus trichocarpa (black cottonwood): POPTR_0015s10220gHelp
Entry
POPTR_0015s10220g CDS       T01077                                 

Gene name
POPTRDRAFT_776218
Definition
radical SAM domain-containing family protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
Enzymes [BR:pop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     POPTR_0015s10220g (POPTRDRAFT_776218)
Transfer RNA biogenesis [BR:pop03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    POPTR_0015s10220g (POPTRDRAFT_776218)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LGXV
AA seq 563 aa AA seqDB search
MATAVITETKKLPRPGRGGYQPHGLTEEEARVRAIAEIVNSMVDLSRKNQTVDLNALKSA
ACRKYGLARAPKLVEMIAALPDSDRESLLPKLRAKPVRTASGIAVVAVMSKPHRCPHIAT
TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSVDK
VEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVAYSEHGATKCIGMTIETRP
DYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVAH
MMPDLPNVGVERDLESFREFFESPCFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPEQ
LVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVRTR
EAGIQDIHHKIKPEEVQLVRRDYTANEGWETFLSYEDTRQDILVGLLRLRKCGRNVTCPE
LTGKCSIVRELHVYGTAVPVHGRDAEKLQHQGYGTLLMEEAEQIARKEHRSTKIAVISGV
GTRHYYRKLGYELEGPYMVKSLS
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgcagtaattaccgagaccaaaaaactcccgcgacctggtcgcggcggttac
caacctcacggactaaccgaagaagaagctagagtccgagccatagccgaaatcgtcaat
tccatggtagacctttcacgaaaaaaccaaaccgtcgatcttaacgcactaaaatctgcc
gcatgtcgcaaatacggcctcgcacgtgctccaaaactcgtcgagatgatcgcagcgttg
ccggattctgaccgcgagtcactgctaccgaaactccgagccaaaccggtacgcacggca
tcaggaattgcagttgttgctgtcatgtcgaagcctcaccggtgcccgcatatcgcgacg
acggggaatatttgtgtgtattgtcctggtggaccagactcagattttgagtacagtacg
cagtcgtatactggttatgaacctaccagtatgcgtgcgattcgagctagatataaccca
tatgtccaggctagaagcaggattgatcagcttaagagactgggtcatagcgtggataag
gttgagttcatattaatgggtggtactttcatgtcattgccagcagattaccgtgattac
tttataaggaaccttcacgatgctttatcagggcacacttctgccaatgttgaagaggca
gttgcctactctgagcatggtgcaaccaagtgcattggcatgacgattgaaacgaggcca
gattattgtcttggtcctcatctacgccaaatgctttcatatgggtgcacacgattggag
attggagttcaaagcacatatgaggatgttgctcgagacactaatagaggacacacggta
gctgctgtggctgattgtttttgcttggcaaaggatgctggttttaaggttgttgctcat
atgatgcctgatcttccaaatgtaggggttgagagggacttggaaagttttcgagagttc
tttgagagtccttgttttagagctgacgggctcaaaatttatcctacacttgtaattcgt
ggaactgggctttatgagctatggaaaactggcaggtacagaaattatccacctgagcaa
cttgtagatattgtagcaaggatcctagccatggtacccccttggacgcgagtttataga
gttcaacgggatattcctatgcctttggttacatctggagttgagaaaggaaatcttagg
gagttagccttagctcggatggatgacttgggcctgaaatgccgtgatgtccgtacacgt
gaggctggaatccaggatattcatcacaagattaagccagaagaagttcaacttgttcgc
cgtgattatacagccaatgaaggctgggaaacatttctttcctacgaggatacacgccag
gatattcttgttgggttactgcgcttacgaaaatgtggccgcaacgttacttgccctgag
cttacggggaagtgctctattgttcgtgaacttcatgtttatggaactgcagttcctgtt
catgggcgtgatgcagagaagctgcaacaccagggttatggtacacttttgatggaagag
gcagaacagattgctcgcaaggagcatagatcgaccaaaatagctgttatttcaggagta
ggaacccgccattactatagaaaattgggctacgagcttgaagggccatacatggtgaaa
tccctttcttaa

DBGET integrated database retrieval system