KEGG   Populus trichocarpa (black cottonwood): POPTR_0019s10160gHelp
Entry
POPTR_0019s10160g CDS       T01077                                 

Gene name
POPTRDRAFT_1108286
Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pop00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    POPTR_0019s10160g (POPTRDRAFT_1108286)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    POPTR_0019s10160g (POPTRDRAFT_1108286)
Enzymes [BR:pop01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     POPTR_0019s10160g (POPTRDRAFT_1108286)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 947 aa AA seqDB search
MENGLAAAEGEEKLFPDTHAQKVDPGKPASLTWKRQLNSNGKIPVQFGLSFREISHMLPM
GLRLWRHIKQEAAKERATIFDFSKKHILTSDHGIPLGGIGAGSIGRSYRGEFQHFRLFPG
ICEEGPVLANQFSAFVSRPSGETFSSVLCSRTPDIPKESTGSGIESWDWNLNGQKCTYHA
LFPRAWTIYDGAPDPELTIVSRQISPFIPHNYKESSFPVSVFTFTLSNHGKTSADVTLMF
TWANSVGGVSGLSGHHFNSKMMTKDGVHAVTLHHKMTNRQPPVTFAIAAQETADVHVSEC
PCFLISGDSQDVSVTAKDMWDGIKKNGTFDQIGCNKTSPSEPGSSIGAAIAASVTVPSGS
IRTVTFSLSWDIPEIRFSERSYHRRYTKFYGTLGDAAANIARDAILEHANWESQIEAWQR
PILEDKRVPEWYPITLFNELYYLNAGGTIWTDESPPMQNLTAVRERRFSLERSSSGYKNV
NGIAHKNDTAIEILERMASTYEQLHNPVSSNSVFGANLLQNGEENIGQLLYLEGTEYLMW
NTYDVHFYASFALVMLFPKLELNLQRDFAAAVLMHDPSRMQIMSDGKWVPRKVLGAVPHD
VGLNDPWFEINAYNLFSTARWKDLNCKFVLQVYRDVVATGDKDFARAVWPSVYVAMAYMD
QFDKDGDGMIENEGIPDQTYDTWSVTGVSAYCGGLWVAALQATSAMAHEVGDDGSANYFW
IKYQKAKTVYGKLWNGSYFNYDSSGNKSIQADQLAGQWYARACGLSPVVDGDKARKALEK
IYEFNVLKVKGGTRGAVNGMLPDGRVDLTAMQTKEIWPGVTYALSASMIQEGLEEMAFQT
AVGIYNAAWSEEGLGYSFQIPESWDMNDQYRSLCYMRPLAIWAMQWALSKPKDFKEEMHH
EGIEDESYLKQHAGFSKVAHLLRLPEEEAPKSFFQAVYEFTCKRMLF
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atggagaatggtctcgcagcagctgaaggtgaagagaagctttttcccgatacccatgca
cagaaggtcgatccgggaaaacctgcttcactgacatggaaaaggcaattgaatagcaat
ggaaaaatccctgtgcagttcggtctaagtttccgagaaatatcacatatgttaccgatg
ggcctgagactgtggcgtcacatcaagcaagaagcagcaaaagaaagagcaacaatattt
gatttttccaagaagcacattcttacaagtgatcatgggatccctttaggtggtatcggt
gcaggaagcattggaagaagctatagaggcgagtttcaacactttagactgttccctgga
atatgtgaagaaggcccagttttggcaaatcaattttccgcttttgtttcccgtccgagt
ggtgaaacgttttcctctgtattatgctctaggactccagacatacccaaagaaagcaca
ggttcaggcattgaatcttgggattggaatctgaatggccagaagtgtacatatcatgct
ctttttcccagggcttggacaatctatgacggtgcacctgacccagaacttacaattgtt
tctcgacaaatttcacctttcattccccacaactataaggagagcagtttccctgtatca
gtttttactttcacgctatctaatcacggaaaaacttcagctgatgtcaccttaatgttt
acatgggcaaattctgtgggtggggtctctggactttctggtcatcatttcaactcaaag
atgatgacaaaagatggagttcatgcagtcacgttacaccacaaaatgacaaatagacag
cctccggtaacctttgccattgcagcacaggagacggcggacgttcatgtttctgaatgt
ccttgtttcctgatatctggagattcccaggatgtcagtgtcacagcaaaagatatgtgg
gatggaattaaaaagaacgggacatttgatcagattggttgtaataaaacttcaccttca
gaaccaggatcatctattggagcagccatagcagcctctgtgaccgttccttctggctct
atccgcaccgtcacattttcgttatcatgggacatcccagaaataagatttagtgaaaga
agttaccacaggcgttatacaaaattctatggcacactaggagatgcagctgccaacatt
gcacgtgatgctattcttgagcatgctaactgggaatcccagatagaagcatggcaaaga
cctattcttgaagacaaaagggttcctgaatggtaccctatcactctcttcaatgagctc
tattatctcaatgcaggagggacaatttggacagatgaatcacctccaatgcaaaattta
acagctgttagagaaagaagattttctctcgaaaggtcaagttcaggttacaagaatgta
aacggtattgctcataagaatgacacggctattgaaatcctggaaaggatggcatccacg
tatgaacaactacataatccggtatcatcaaattccgtttttggagcaaatttgcttcag
aatggagaagaaaatatcggccagctcctttatcttgaaggaactgaatacctaatgtgg
aatacctatgatgttcatttctatgcatcttttgcacttgtaatgctatttccaaaactt
gaactcaatctccaaagagacttcgcagctgcagtactgatgcatgatcctagtaggatg
caaattatgagtgatgggaagtgggttccacgaaaggttcttggtgctgttcctcatgat
gttgggcttaatgacccctggtttgaaataaacgcctataaccttttcagtacagctagg
tggaaggacttgaactgtaaatttgttctccaggtgtacagggatgtggttgctactggt
gataaagattttgctcgagctgtttggccttcagtatatgttgcgatggcttatatggat
caatttgacaaggatggagatggaatgattgaaaatgaggggatacctgatcaaacctat
gatacatggtctgttactggtgtaagtgcatactgtggtgggctttgggtggcagcactc
caggctacatcagccatggcacatgaagttggtgatgatggatctgctaattatttctgg
attaagtatcaaaaggcaaaaactgtttatggcaagttatggaatggttcctacttcaac
tacgacagcagtggtaataagtctatacaagctgatcaattggctgggcaatggtatgct
agagcgtgtggcctttcaccggtcgtcgatggggacaaagccaggaaggcattggagaag
atttacgagttcaatgtcttgaaggtgaaaggaggaacgcgtggggctgtgaacgggatg
ctaccagatggaagagttgatctgacggcaatgcaaacgaaagaaatatggcctggtgtt
acctacgctctttctgcttctatgattcaagagggactggaggaaatggcttttcagact
gcagttggtatctacaatgcagcatggtccgaagaaggtcttggttattcattccagatt
ccagaaagttgggacatgaatgatcaatatcggtctctttgctacatgcgacctttagcc
atatgggcaatgcagtgggccttatcaaaacctaaggactttaaagaagagatgcaccat
gaagggatcgaggacgagtcctatcttaagcaacatgcaggattttccaaagtagctcac
cttcttaggttgccggaagaggaagcaccaaaaagcttctttcaggctgtttatgagttt
acttgcaagagaatgctattttaa

DBGET integrated database retrieval system