KEGG   Populus trichocarpa (black cottonwood): POPTR_1109716Help
Entry
POPTR_1109716     CDS       T01077                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pop01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:pop00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 341 aa AA seqDB search
MAFLFPYFAFLFVVFIFVIDPVAHSLPFIVLHGIGDQCKNRGVKQFTEELTNFSGSPGYC
LEIGDGTWDSWFMPLEEQTEIVCDKVKKMKELSKGYSIVGLSQGNLIGRGVVEFCDGGPP
VKNFISLGGPHAGTASVPLCGSGIFCKLADALIKSKIYSDYVQAHLAPSGYLKFPNDIPH
YMEKCRFLPKLNNEIPEERNTTYKERFSSLQNLVLIMFENDNVLIPKETSWFGYYPDGAF
KPIVPAHQTALYTEDWIGLKALDEAGRVHFVNVSGGHLGISESDMKKHVVPFLVDEASVE
NFIDETSNERILDGSSSYQWPSSVKNFFRELVGLAEENDSD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcttttctcttcccttattttgcctttctcttcgttgtttttatttttgttattgac
ccagttgcacattccttaccctttatagttcttcatggtattggagatcaatgcaagaat
cgaggagtaaaacagttcactgaggaactgacaaacttttctggttctccaggctattgc
ttagaaatcggggatggaacatgggattcctggtttatgcctcttgaggaacagacagaa
attgtttgtgacaaggtcaaaaaaatgaaagaactgagcaagggctatagcatagttggt
ctttcccagggcaacttaattggtcgaggtgtggtagagttttgtgatggtggacctcct
gttaagaatttcatttctttaggggggccacatgctgggactgcctctgttcctctttgt
gggtctggcattttttgcaaacttgctgatgccttaattaagtccaagatctatagcgac
tatgtccaggctcacctggctcccagtggctatcttaaatttcctaatgatattccacac
tacatggagaaatgtaggtttcttccaaagcttaacaatgaaattcctgaggaaaggaac
acaacttacaaggaaagattcagtagcttgcagaatttggtgcttattatgttcgaaaat
gacaatgttttgatacctaaggagacctcttggtttggatattatccagatggggctttc
aagccaattgtcccagcacatcagacagcgctttacactgaggactggattggtctcaag
gccttagacgaggctggaagagttcatttcgttaatgtgtcaggaggtcatcttggaatc
tctgagagtgatatgaaaaagcatgttgtgcctttcttggtggatgaagcttcagtagaa
aactttattgacgaaacatcaaatgaaaggatactcgatggatcatcatcttatcagtgg
ccatcttcagtaaaaaactttttcagggaactagtaggtcttgctgaggagaatgattca
gattga

DBGET integrated database retrieval system