KEGG   Populus trichocarpa (black cottonwood): POPTR_1110019Help
Entry
POPTR_1110019     CDS       T01077                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pop01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pop00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:pop00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:pop00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 415 aa AA seqDB search
MQGLKSAAALLIRSCCNNNKSKLSHSFLTHCPQHSRSLSSSPPTEDDLDNQVLVEDKANS
RSAILNRPSALNALNTNMGARLLKLYKAWEKDSSVGFVTLKGSGRAFSAGGDIVNLYHLI
NQGKWEACREFFGTLYTFIYVLGTYLKPHVAILNGITMGGGTGISIPGTFRLATDKTVFA
TPETLIGFHPDAGASFFLSHLPGHLGEYLALTGGTLNGAEMIACGLATHYTNSEKLHLVE
HHLGKLVTDDPSVIETSLEQYGDLVYPDKMSVLHRIEMVDKCFSHDTVEEIFDALEREAA
ETNDAWFNSTLRRLKEASPLSLKVSLRSIQEGRFQTLDQCLVREYRMSLQGISKQISGDF
CEGVRARMVDKDLAPKWNPPSLEQVSEDMVDRYFSPLSESEPDLDLPTKQREAFT
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcagggtttgaaatcagcagcggctctattgattagaagctgctgtaacaataataaa
tctaagctttcccatagctttctcacacattgcccgcagcacagcagaagcctctcttct
tctcctccaactgaagatgatcttgataaccaagtactcgttgaagacaaagctaattca
agaagtgccattcttaatagaccttcagctcttaatgctcttaatactaatatgggtgct
agattgttaaaattgtataaagcttgggagaaagactcaagtgttgggtttgttacatta
aagggcagtggcagggcattttctgctggtggagatattgttaatctctatcacctaata
aaccaggggaaatgggaagcgtgtagggaattttttgggactttatatacattcatatac
gtactaggtacatatttgaagccacatgtggctattttgaatggcattaccatgggtggt
gggactggaatttcaatccctggaacatttcgacttgcaacagacaaaactgttttcgcc
acacctgaaactctgattggattccaccctgatgctggagcatccttcttcctctcacat
ctacctggtcacttaggtgagtacttggctttaaccggaggaacgcttaatggagcagaa
atgattgcttgtggcttagctacacactacacgaatagcgaaaaacttcatttagttgaa
catcatcttggaaaactggtcactgatgatccttctgtcattgaaacttctttagaacaa
tatggtgaccttgtctatccagataagatgagtgtacttcacaggattgaaatggtcgat
aaatgtttcagccatgacacagttgaagaaatctttgatgctctggaaagggaagctgct
gaaacaaacgatgcatggttcaattccactctaagaagacttaaagaagcgtcaccattg
agcttgaaggtttccttgagatctatacaagaaggtagatttcagacacttgatcagtgc
ttggtccgtgaatatcgaatgagcctacaaggaatatccaagcaaatctctggtgatttt
tgtgagggggttcgggcacgaatggtggacaaggacttggcaccaaagtggaatcctcca
agcttggaacaagtgtctgaggacatggtggaccgctatttctctcctcttagtgaatcc
gaaccggatctagaccttccaacaaaacaacgggaagcttttacatag

DBGET integrated database retrieval system