KEGG   Populus trichocarpa (black cottonwood): POPTR_1120967Help
Entry
POPTR_1120967     CDS       T01077                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
pop  Populus trichocarpa (black cottonwood)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 749 aa AA seqDB search
MNDMDKTLDDANLQMDQDILVEVHDIANGTALSRFIRSAQDNGPTVKDASSFHLEPSKSS
LSIAGGLSASKGASRGCSAEPSQSPNLTSQGPNLTYQGRELDNAYGTSTVTTRGSSGGLI
GLQNLGNTCFMNSAIQCLVHTSEFAEYFREDYHQEINWKNPLGMVGELALAFGELLRRLW
APGRTAIAPRQFKMKLARFAPQFSGYNQHDSQELLAFLLDGLHEDLNRVKHKPYKKSKDA
DGRPDEEVADEYWASHIARNDSIIVDVCQGQYKSTLVCPECNKISVTFDPFMYLSLPLQS
TTTRSMTVTVFTCDGSALPFACTVTVPKQGRCRDLMNALSCACSLKNSEELKLAEVRNHL
FQRFLEDPLISLSTIKDDDHLAAYKIAKSLKKTLLLRLIHRCQEQETGDTKAAQKLKPFG
TPLVSLISHDDVITRGDIQKVVHTMLSPLLRSESLRQADIPEPCSSLAASDMCHHSSSDE
ACTNPLSDSMNKDSSGSRAVTLFKLPLQLVEESNACIDLSVGEDKTIKLSSTSTSMLVYV
DWSQELLEKYDIHYLENLPEVFKYGPVNKKARTEPLSLYTCLEGFLREEPLVPEDMWLVY
CPKCKERRQASKKLDLWRLPEVLVIHLKRFSYSRSMKHKLETFVNFPIRDFDLTNYIANK
NNTQRQLYELYALTNHYGGMGSGHYTAHIKLLDENRWYNFDDAHISPINEEDVKSAAAYV
LFYRRVKTVDAISNGENSGTGHNNGSSLK
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacatggataaaacacttgatgatgccaacttacagatggatcaggatattctg
gtggaggttcatgacattgccaatggtactgcattgagtcgttttataagatctgctcag
gacaatggaccaactgtgaaggacgctagttcttttcatttagagccttctaagtcaagc
ttatcaattgcaggaggtttatctgcaagcaagggtgcttctagaggctgcagtgcagag
ccatctcaaagtccaaatctgacatcccagggtccaaatctgacatatcagggtagggag
ctggataatgcatatgggaccagtactgttactacaagggggtcttctggtggcttgatt
gggttgcagaacctagggaacacatgctttatgaatagtgcaatacaatgtcttgttcac
acatcagagtttgctgaatattttcgagaggattatcatcaagagataaattggaaaaac
ccactgggtatggtgggtgagcttgctcttgcatttggtgagttacttcgaaggttatgg
gcacctgggcgaacagcaattgctcctcgacaatttaaaatgaagttggctcgatttgca
cctcaatttagtggctacaatcagcacgattctcaggagcttttagcatttcttttagat
ggtcttcatgaagatctgaatcgtgttaaacataagccatataaaaagtcaaaagatgct
gatggtcgcccagatgaagaagttgctgatgaatattgggcaagtcatattgctcgtaat
gattctataatcgttgatgtgtgccagggccaatacaagtcgactttggtttgtccagag
tgcaataaaatctctgttacgtttgatcctttcatgtacctctctttgccacttcaatcc
accactacacgttctatgacagttacggtttttacatgtgatggaagtgccttgccattt
gcttgcacagtgactgttccgaaacagggacgatgcagggacttgatgaatgcacttagc
tgtgcttgttccttgaagaatagcgaagagcttaaacttgctgaggtacgaaaccattta
tttcaaaggtttctagaagaccccttaatatccctctccacgattaaagatgatgaccac
ctagctgcctacaagatagcgaagtcgctaaagaaaacacttctgcttaggttgattcat
cgctgtcaagaacaggaaacaggtgatacaaaggctgcacagaagttgaaaccctttgga
acgcctcttgtctctttgatctcacatgatgatgtaattacgagaggtgatatacagaaa
gtagttcacacaatgctctcacctttgttgagatctgaaagtttgagacaagctgacatt
cctgagccttgctcgtcattggcggcatcagatatgtgccaccacagcagttctgatgaa
gcatgtactaaccccttatccgattcaatgaacaaggatagtagcggttccagggcagta
acattattcaaactaccgcttcagttggttgaggaaagtaatgcatgcattgatctgtcc
gtgggagaagacaaaacaattaaattatcctcaacatcaacatcaatgttggtatatgtt
gattggtcacaggagctcttagaaaagtatgacattcattatttggaaaacttgcccgaa
gtgttcaagtatggacctgtgaataagaaagctcgtactgaacctctctccttgtacacc
tgtctagaaggttttctgcgtgaagagcctttggtgcctgaagatatgtggttagtgtac
tgcccaaaatgtaaggagcggaggcaagcaagtaaaaagcttgacttatggaggcttcca
gaagtgttagtcatccatttgaagaggttttcctatagcagatcaatgaagcataaacta
gaaacttttgtcaactttcctattcgtgactttgatttgacaaattacatagccaacaag
aacaacactcaacgtcaactctatgagctatatgcattgaccaaccattatggtggcatg
ggaagtgggcactacactgcacatatcaagcttctggatgagaacaggtggtacaacttt
gatgacgctcacatatcacccataaatgaagaagatgtgaagtcagctgctgcgtatgtt
ctcttttatcgaagggtgaagacagttgatgccattagcaatggagaaaattctggtact
ggtcataacaatggttcatccctgaagtga

DBGET integrated database retrieval system