KEGG   Populus trichocarpa (black cottonwood): POPTR_204417Help
Entry
POPTR_204417      CDS       T01077                                 

Definition
hypothetical protein
Organism
pop  Populus trichocarpa (black cottonwood)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 688 aa AA seqDB search
MGSKWRKAKLALGLNMCLYVPPTDVEQRDSSSSPSPARLFSRSSHGSTTPTPSSSGLRLS
TSPDSNNKRTCAICLTAMKTGQGQAIFMAECSHSFHFHCIASNVKHGNQICPVCRAKWKE
IPFQRSVSDVTCGKPRMSALGWPQDDAWMTVLRRLPPARTDANRHISSHYQANEPAIFDD
DEDLDPQHETAEGNTSTQDAGDVNSVRTVEVFTYTEVSAVPKSVSYDNFTILIHLKAPLT
SGRQNRNWNHAESPQSSQDSRAPVDLVTVLDVSGSMSGTKLALLKRAMGFVIQNLGPSDR
LSVIAFSSTARRHFPLRRMTETGKLEALQAVNSLVSSGGTNIAEGLRKGFKVVVDRKWKN
PVCSIILLSDGQDTYTISGTSMTRPQADYKSLLPTSIHRNGSSGFRIPVHAFGFGSDHDA
ASMHSISEISGGTFSFIEAEGVIQDAFAQCIGGLLSVVVQELQVKVESLHPRLEIGSIQA
GSYKSSIMANAIMGFVDVGDLYAEEERDFLVTVNIPVDGTSDEMSLLKVSCTYRDPMTKG
MMTLEEASQVKIQRPEITGTRVVSMEVEKQRNRLRAAEAMAEARAAAENGDLARAVSVLE
SCGKALSETASTRAGDRLCIALCAELKEMQERMASRRVYETSGRAYILSGLSSHSWQRAT
ARGDSTDSTNLMQAYQTPSMADMVTQSQ
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcaaatggagaaaggcaaaattagctcttggcctgaacatgtgtctttatgtc
cctccgactgatgttgaacaacgtgattcttcctcctcaccttctcctgctagactattc
tcccgctcctctcacgggtccactactcctaccccttcttcttccggcctccgcttgtcc
acatcccccgatagcaacaataagaggacctgtgcaatatgcctgactgccatgaaaacg
ggacagggccaagccatttttatggcagaatgctcccactccttccacttccattgcatt
gcctctaatgtaaagcatgggaaccagatttgtccagtttgccgagcaaagtggaaagaa
atcccctttcaaagatctgtttctgatgttacttgtggaaagccaagaatgagcgcacta
ggttggccccaagatgatgcttggatgactgttctaagacggcttcctccagctcgaaca
gatgcaaacaggcatatttcatcacattatcaagccaatgaaccagctatctttgatgat
gatgaagacttggatccgcaacacgagactgccgagggaaacacatccactcaagatgct
ggtgatgttaattctgtgagaactgtagaggttttcacatatacagaagtttcagcagtt
ccaaaatcagtctcttatgataatttcaccatactaatccatctcaaggcccctcttaca
agtggaagacagaataggaactggaatcatgctgaatcaccacaatcatctcaagattct
cgtgctccggttgatctcgttaccgtgcttgatgttagtggcagcatgtctggtacaaag
cttgctttgctaaaacgagctatggggtttgtgatccagaatctgggtccatctgaccga
ctgtctgttattgccttctcatccacagcccgacgccactttcctcttcgtcgcatgaca
gagaccggaaagctcgaggccttacaggctgttaattctctggtttctagtggtgggaca
aacattgctgaaggtctaaggaaaggtttcaaggtggtggttgatcgcaaatggaagaat
ccagtttgtagcatcatactattatctgatgggcaggatacatatactatctctggcaca
agcatgacccgtcctcaagcagattacaaatctcttctcccgacatcaattcaccggaat
ggtagctcggggttccgtattcctgtgcatgcatttgggtttggttcagaccatgatgct
gcatcaatgcattcaatttctgagatttcaggtggcacattttcattcatagaagctgag
ggtgtaattcaggatgcatttgcacagtgcataggagggctattgagtgtggtggtgcaa
gagctacaggtcaaagttgagtctcttcatccaagattggaaattggttcaattcaagca
ggtagttacaaaagcagcatcatggccaatgcaattatgggctttgttgatgttggagac
ttgtacgccgaagaagaaagggatttcttggtaacagtcaatattccagttgatggtacc
agtgatgagatgtcattgctaaaggtcagttgtacttacagagatcctatgacaaaaggt
atgatgactcttgaggaagctagccaagtaaagatccaaaggcccgaaataaccggaaca
cgagtggtgtcaatggaagtagagaagcaacgaaacagactccgtgcagcggaggcaatg
gctgaggctagagctgcagctgaaaatggtgatctagctcgtgcggtctctgtcctggag
agctgtggcaaagcattgtcagaaactgcatctactcgggcaggtgacagactgtgtatt
gcactgtgcgcggagttgaaggagatgcaagaacggatggcaagccggcgggtatatgaa
acatctggaagggcttacattctatcaggtttgagctcacactcatggcaaagagcaact
gcgcgaggtgattccactgacagtacaaacctcatgcaagcttaccagacgccatcaatg
gcggacatggtaacccagtctcag

DBGET integrated database retrieval system