KEGG   Populus trichocarpa (black cottonwood): POPTR_280952Help
Entry
POPTR_280952      CDS       T01077                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:pop01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pop01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pop00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pop00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pop00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pop00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 443 aa AA seqDB search
GFVLEDVPHLTDFLPHLPSYPNPLHHSHAYAIVKQTFVGPEDAVAQNIVVHKDSPRGVHF
RRAGPREKVYFMPDEVRACIVTCGGLCPGINTVIREIVCGLNYMYGVDDVLGIMGGYRGF
YSKNTINLTPKVVNDIHKRGGTFLCTSRGGHDANKIVDNIQDRRINQVYIIGGDGTQRGA
ALIYKEVEKRGLQVAVAGIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEVESVENG
VGIVKLMGRYSGFIAMFATLASRDVDCCLIPESPFYLEGPGGLFEFIEQRIKENGHMVIV
IAEGAGQEYVAQAMQAADERDASGNRLLLDVGLWLTQKVKDHFTKVKKMEINMKYIDPTY
MIRAIPSNASDNIYCSLLAQSAVHGAMAGYTGFTVGPVNSRHAYIPIARVTEAQNTVKVT
GRMWARLLASTNQPSFLNSNEML
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ggtttcgtcctcgaagatgtgcctcacttgactgatttcctccctcatctaccatcgtat
ccaaatcctttacatcacagccatgcctacgcgattgtcaagcagacttttgttggacca
gaagatgcagtcgcacaaaatattgttgttcataaagatagtcctagaggtgtccatttc
cggcgagccggccccagagagaaggtgtattttatgcctgatgaagtgcgtgcttgcata
gtgacatgtgggggtttatgtcccgggatcaatacagtgattcgcgagattgtatgcgga
ttgaattatatgtatggagttgatgatgtacttggcattatgggaggttataggggtttt
tattcaaaaaacaccataaatttgacgcccaaagttgtgaatgatatacataagcgtggt
ggcacatttctttgcacttcacgaggaggtcatgacgcaaacaagatagttgataatatt
caggacaggagaataaatcaggtatatattattggaggtgatggcactcagagaggagca
gctttaatttacaaggaagttgagaaacgtggtcttcaagtggctgttgctgggatcccc
aagacgattgataatgatatagcggtgatagacaaatcttttggatttgataccgctgtt
gaagaagctcagagagcaattaatgctgcacatgtggaggttgaaagtgtggaaaatgga
gttgggattgttaaactgatgggcagatacagtggtttcattgcaatgtttgcaactttg
gcaagtcgagatgtggattgttgcttgattccagaatcgccattctatctagaaggtcct
ggtggtctttttgaatttattgaacagaggatcaaagaaaatgggcatatggttattgtg
atagcagaaggagccgggcaggaatacgtagctcaggccatgcaggcagctgatgagaga
gatgcatcagggaacagactacttcttgatgttggtctgtggttaactcaaaaggttaag
gatcattttacaaaggtgaagaagatggagataaatatgaaatatatagatcctacatac
atgattagagctatcccaagtaatgcatcagacaacatttattgcagtcttctagcacaa
agtgctgttcatggggccatggctgggtacacaggattcacagttggtccagtaaacagc
agacatgcttatattcccattgctcgtgtgacagaggcacaaaatacagtgaaggtaaca
ggtaggatgtgggccagacttcttgcttcaacaaatcagcctagtttcttgaattccaac
gagatgctg

DBGET integrated database retrieval system