KEGG   Populus trichocarpa (black cottonwood): POPTR_558388Help
Entry
POPTR_558388      CDS       T01077                                 

Definition
hypothetical protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:pop01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pop00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pop00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:pop00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 412 aa AA seqDB search
MSSTAGQVIRCKAAVAWEAGKPLVMEEVEVAPPQAMEVRLKILFTSLCHTDVYFWEAKGQ
TPLFPRIFGHEAGGIVESVGEGVTDLKPGDHVLPVFTGECKECRHCKSEESNMCDLLRIN
TDRGVMLNDGKSRFSIRGQPIYHFVGTSTFSEYTVVHVGCLAKINPAAPLDKVCILSCGV
STGLGATLNVAKPKKGSSVAIFGLGAVGLAVSFFSNTRLASNFPIQNVDADAKLVRVVSI
SQAAEGARIAGASRIIGVDLNSNRFNEAKKFGVTEFVNPKDYKKPVQEVIAEMTNGGVDR
SVECTGSINAMISAFECVHDGWGVAVLVGVPNKDDSFKTHPMSFLNEKTLKGTFFGNYKP
RSDLPSVVEMYMNKELELEKFITHEVPFSEINKAFDYMLSGASLRCIIRMEA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcactgctggtcaagtcattcgttgcaaagctgctgtggcatgggaagctgga
aagccattagtgatggaggaagtggaggtggctccaccacaagctatggaggttcgtttg
aagatcctcttcacttccctctgccatactgatgtttacttctgggaagccaaggggcaa
accccattgtttcctcgcatattcggccacgaagcaggagggattgtcgaaagtgttggt
gagggggtgacagacctgaaacccggtgaccatgtgcttcctgtcttcacaggagagtgc
aaggaatgccgacattgcaaatcagaggagagtaatatgtgtgatcttctgaggatcaac
actgacagaggtgtgatgttgaatgatggaaagtctagattttcaattagagggcagccc
atttaccactttgttggtacctcaacctttagtgagtacactgtggttcatgttggctgt
cttgccaagatcaatccggctgctcctcttgacaaagtttgtatcctcagctgtggagtt
tcaacaggtcttggtgccaccttgaacgttgcaaaaccgaagaaaggctcgtcagtagcc
atttttggactaggagctgtaggccttgcagtaagtttcttttccaatacaagattagcg
agcaattttcctattcagaatgtggatgctgatgcaaaacttgttcgtgttgtttctata
tcacaggctgctgaaggggctcgaattgctggtgcttcaagaatcattggtgtcgatttg
aattccaataggttcaatgaagccaagaaattcggtgtcacggagtttgtaaacccaaaa
gattataagaagcctgttcaagaggtgatagctgagatgaccaacggaggagttgatcga
agtgtcgagtgcactggaagtatcaatgccatgatttctgcctttgaatgtgtccatgat
ggatggggtgttgctgtacttgttggtgtgcccaacaaagatgattctttcaaaacccat
ccaatgagtttcctgaatgagaagactctcaagggtaccttctttggcaactacaaaccg
cgctccgaccttccttcagtggttgaaatgtacatgaacaaggagcttgagctggagaaa
ttcatcacccatgaggtccctttctcagaaatcaacaaggcttttgactacatgcttagt
ggagcaagtctcaggtgtatcatccgcatggaagcgtaa

DBGET integrated database retrieval system