KEGG   Populus trichocarpa (black cottonwood): POPTR_583163Help
Entry
POPTR_583163      CDS       T01077                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:pop03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:pop03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:pop03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pop03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 282 aa AA seqDB search
MFSSSQFDATSAFSGGGFMPSQSTQLTDSTPSPAKASLLSLSLSSRNSLGVVPVTVKQIS
QASQSGDEKSSFVINGVDVTNVTVVGMVFNKAEKSTDVSFVIDDGTGRIGCRRWVTENFD
KLEMEAVQDGMYVRVIGHLRVFQDVKQLVAFSVRPVTNFDEITFHFIDCIHSHLQNSKLQ
GGASTQLHMVESSMNTPVRNGQTFTSNLMSKQFDVDGLKDCDQLVLDRLQQSSSIGQEKG
MHMDELCQQLKLPMEKIKESIRSLEDEGLIYSTIDEFHYKAT
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaagcagccaattcgacgccacctccgccttctccggcggcggattcatgcct
tctcaatccactcagctcaccgattccacaccttctcccgctaaagcaagccttctctca
ctctctctctctagtcgcaattcgttgggtgtggttccagttacggtgaagcagataagc
caagcttctcaatctggtgatgagaagtcaagttttgtgatcaacggtgtggatgttacc
aatgttacggttgttggaatggtgtttaataaagctgaaaagtcgactgatgttagtttt
gtcatagatgatggaacaggccgtattggttgtagaagatgggtgaccgagaattttgac
aaattggaaatggaggcagtacaagatggaatgtatgttcgagttattggacacttgaga
gtttttcaagatgtcaagcagttggttgctttctctgtcaggcccgtgacaaactttgat
gagattacttttcattttatagattgcatacattcccatttgcagaattccaaattgcag
ggtggagcttcaactcagcttcatatggtagaatcatcaatgaacactcctgtgcggaat
ggtcagacattcacatcaaacctgatgtccaagcaatttgatgttgatgggctaaaggat
tgtgatcaattggtccttgatcgtctgcaacagtcttcaagcattggacaggaaaaaggg
atgcacatggatgaactttgccaacagctgaaacttcccatggagaagatcaaggaatct
attagatcacttgaagatgaaggtttaatatactctacaattgacgagtttcactacaaa
gcaacctga

DBGET integrated database retrieval system