KEGG   Populus trichocarpa (black cottonwood): POPTR_583485Help
Entry
POPTR_583485      CDS       T01077                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pop00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:pop00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 948 aa AA seqDB search
MFERKISGNGFDEEQGEPSNYPVDKVDAGKPAPLTWQRKLDGDETVLSQFTLSLQEKLLM
APIGIRLWRHIREENARKRGGFYMDPFAKRNVTSCLGIPVGGIGSGSIGRSYKGEFQRWQ
LFPRICEEKPVLANQFSIFVSRSNGKKYSSVLCSRSPDVLEEAAGSGIESWDWNLKGNNS
TYHALYPRAWTVYEGEPDPELRVVCRQISPIIPHNYKESSFPASVFTFKLYNSGKTSADV
TLLFTWANSVGGVSEFSGQHLNSTKMMEDGVHCALLNHKTANGLPSVSFAIAAQETPVVH
VSKCPCFVISGNSQGVTAKEMWNEVKEHGSFDNLNSPGKLVPSEPGSSIGAAVAATSTVP
PDGVCTVTFSLAWDCPDVKFGSGRTYHRRYTKFYGTHGDAAANIAHDAILEHGLWESEIE
AWQRPILEDKRLPEWYAGTLFNELYYLNSGGTVWTDGSPPFRSLATIEGSKFSLDRAGSN
LGHQGDTAVDILGRMTSALEEIHTPLTTNSAFGTNLLQEGEENIGQFLYLEGIEYHMWNT
YDVHFYASFAFIMLFPKLQLSIQRDFAAAVMMHDPSMMPLLHDGQRVPRKVIGAVPHDIG
IHDPWFEVNAYNLHNTDRWKDLNPKFVLQVYRDVIATGDKKFARAVWPSVYVAMAYMDQF
DRDGDGMIENDGFPDQTYDTWSLSGVSAYCGGLWVAALQAASALAWEVGDKDSAEYFWCR
FQKAKIVYGKLWNGSYFNYDNSGGINSSSIQADQLAGQWYARACGLSPIVDEDKARCALE
KIYNYNVLKVQDGKRGAVNGMLPDGTVDLSCLQSREIWSGVTYAVAATMIQEGLTDMAFH
TASGVYEAVWAEQGLGYSFQTPEGWNTTDQYRSLCYMRPLAIWAMQWALSRPELHRQEMK
LQAEEDSVPVHHAGFAKVARFLKLPHAESSKSHFQSLFEYATTKFGYS
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagagaaagatatcagggaatggttttgatgaagaacaaggagaaccttcaaat
tatccggtggacaaggttgatgctgggaaacctgcaccactgacctggcagcggaaatta
gacggggatgaaactgtcctttcgcagttcactttaagtttgcaagagaaacttttaatg
gcccctataggtattcggctatggcgtcatatccgagaagaaaatgccagaaaaaggggg
ggtttttatatggatccatttgctaagcgcaatgtgacatcttgtcttggcattccagta
ggcggtattggttcaggaagcattggaagaagttacaaaggtgaatttcagcgttggcaa
ctgttccctagaatatgcgaagaaaaacctgttttagcaaatcaattttctatttttgtt
tcgcgctcaaatggtaaaaaatattccagtgtactgtgctcgaggagtccagatgtgctt
gaagaagctgcaggctcagggattgaatcttgggactggaatctgaagggaaataattcc
acatatcatgctttataccccagggcttggactgtatatgagggcgaacctgatccagaa
ctcagggttgtttgtcgtcaaatttcacctattattcctcataattacaaagagagcagc
ttccctgcatcagtttttaccttcaagctctacaattctgggaagacttctgcagatgtc
accttgcttttcacatgggcaaattctgttggaggggtttctgaattttctggtcagcac
ctcaactcaacaaaaatgatggaggatggtgtacattgtgcacttctgaatcacaagaca
gcaaacgggcttccctcggtatcctttgcaatcgctgcacaagagactcctgttgttcat
gtctcaaaatgtccttgcttcgtgatatctggaaactcacaaggtgtcacagccaaagaa
atgtggaatgaagtaaaagagcatgggtccttcgacaacctcaactcacctggaaagctg
gtgccttcggaaccaggatcatctattggggcagccgttgcagcgacttcaacagtccca
ccagatggtgtgtgtacagttactttttcattggcatgggactgccctgacgtaaaattt
gggagtggaaggacttaccacaggcgttacacaaaattctatggtactcatggagatgct
gctgcaaatattgcgcatgatgctattctagagcatggcctttgggagtcagagatagaa
gcctggcaaagaccaattcttgaagacaagagacttcctgaatggtatgctggcactctc
tttaatgagctctattatcttaattcaggggggacagtttggacagatggatcccctcca
ttccgtagcttagcaactattgaaggaagtaagttttctctcgacagggcaggttccaac
ctgggccatcaaggtgatactgctgttgacattcttggaaggatgacttctgcacttgag
gaaatccacactcctttaacaaccaattctgcttttggaactaatttactacaagaagga
gaagaaaatattggtcaattcctttatctagaagggatcgagtatcacatgtggaacacc
tatgatgttcacttttatgcatctttcgccttcattatgctgtttcccaaacttcagctc
agcattcaaagggactttgcagcggcagttatgatgcatgatcccagtatgatgccactg
ctacacgatgggcagcgtgtccccagaaaggttattggagctgtccctcatgacattggg
atccatgacccatggtttgaagtaaatgcctataacctccacaacactgatcgctggaaa
gacttgaatccaaaattcgttctccaggtttacagggatgtgattgctactggagacaag
aagtttgcacgagctgtttggccatcagtttatgttgcaatggcttatatggatcagttt
gacagggatggtgatgggatgattgagaacgacggctttcctgatcagacatatgatacg
tggtctttgtcaggggttagtgcatattgtggtgggctatgggtggcagccttacaggct
gcatcagccctggcatgggaagtaggagacaaggattcggcagaatatttttggtgtagg
tttcagaaggcaaagattgtgtatggcaagttatggaatggttcttacttcaattatgac
aacagcggtggtatcaatagctcatccattcaagctgatcaattggccgggcaatggtac
gcacgagcatgcggactttcacctattgttgacgaggacaaagctcgatgtgcactggag
aagatttataattacaacgtcctgaaggtgcaggatgggaaacgaggggccgtaaatggg
atgctacctgatggaacagttgacttgtcatgcctacagtcaagagaaatatggtccggg
gtcacatacgcagttgctgcaaccatgatccaggaaggcttgacagatatggcatttcat
actgctagtggagtctacgaggctgtgtgggctgaacaaggacttggatattcctttcaa
actcctgaaggttggaacaccactgaccagtatagatccttatgctacatgcggcctttg
gccatctgggcaatgcagtgggccttatcaagaccggaacttcaccggcaggaaatgaaa
ttacaagccgaggaagactctgtgcctgtgcaccatgctggcttcgccaaagttgctcgt
tttctcaagttgcctcatgccgaatcatctaaaagccatttccaatccttgtttgagtat
gctaccaccaagtttggttacagttaa

DBGET integrated database retrieval system