KEGG   Populus trichocarpa (black cottonwood): POPTR_589574Help
Entry
POPTR_589574      CDS       T01077                                 

Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pop00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 730 aa AA seqDB search
MEDNQIVEDKEKQETSTPLSESIIIGKTEAKSRSIPPPGSGQRIYEIDPSLTGFRQHLDY
RYSQYKRIREEIDKYEGGLEVFSRGYEKLGFIRSETGITYREWAPGAKWAALIGDFNNWN
PNADVMTQNEFGVWEVFLPNNADGSPPIPHGSRVKIRMDTPSGIKDSIPAWIKFSVQAPG
EIPYNGIYYDPPEEEKYIFKHPQPKRPESLRIYEAHVGMSSTEPLINTYANFRDDVLPRI
KKLGYNAVQIMAIQEHSYYASFGYHVTNYFAPCSRCGTPDDLKSLIDRAHELGLLVLMDI
VHSHASNNTLDGLNMFDGTDNHYFHSGSRGHHWMWDSRLFNYGSWEVLRFLLSNARWWLD
EYKFDGFRFDGVTSMMYTHHGLQMTFTGNYNEYFGYATDIDAVVYLMVVNDMIHGLFPDA
VSIGEDVSGMPTFCIPVQDGGVGFDYRLHMAIADKWIELLQKKDEDWRMGDIVHTLTNRR
WLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIRLITM
GLGGEGYLNFMGNEFGHPEWIDFPRGDQRLPTGKIIPGNNNSFDKCRRRFDLGDAEYLRY
HGMQEFDRAMQHLEEIYGFMTSEHQYISRKNEGDRVIVFERGNLVFVFNFHWTNSYSDYR
VGCLKPGKYKIVLDSDDPLFGGFKRLDKDAEYFSSEGWYDDRPRSFLVYAPSRTAVVYAL
VEDELEPAEG
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggaagataatcagattgttgaagacaaggaaaagcaggagacatctactcctttgagc
gagtcaataatcattggtaaaactgaagcgaaatctaggtctatccccccacctggctct
gggcagagaatatatgaaatagatccaagtttgacaggtttccgtcaacatcttgattac
cgatattcacagtacaaaagaattcgtgaagaaattgacaagtatgaaggtggtttggaa
gtgttttctcgtggctatgaaaagcttggattcatacgcagtgaaacaggaataacctac
agggaatgggcaccaggagctaagtgggcagcattgattggagattttaacaattggaat
cccaatgcagatgtcatgacccagaatgaatttggtgtctgggaagtgttccttccaaac
aatgcagatggttcaccaccaattccccatggttctcgagtaaagatacgcatggatact
ccttctggcattaaagattctattcctgcttggattaagttctcagtacaggctccagga
gaaatcccatacaatggcatttattatgatccaccggaggaggaaaagtatatattcaaa
catcctcaaccaaagagaccagagtcacttaggatttatgaagctcatgtcggaatgagt
agtacggagccattaatcaacacatatgccaactttagagatgatgtgcttcctcggatc
aaaaaacttggttataatgctgttcagattatggctattcaagagcattcatattatgct
agttttgggtaccatgtcacaaattattttgcaccctgtagtcgatgtggaacccctgat
gatctgaagtctctgatagatagagctcacgagttaggtctgcttgttctcatggatatt
gttcacagccatgcatcgaacaatactttggatggtttgaatatgttcgatggaactgat
aatcactacttccactctggttcacggggacatcattggatgtgggactctcgccttttc
aactatgggagctgggaagtactgaggtttcttctttcaaatgcaagatggtggctggat
gaatataagtttgatgggttcagatttgatggtgtgacttcgatgatgtacacccaccat
gggttgcagatgacttttactggaaactacaatgagtactttggatatgcaactgacata
gatgctgtcgtatatctgatggttgttaatgatatgattcatggtctcttccctgatgct
gttagcattggtgaagatgtcagtggaatgccaacattctgcattcctgtccaagatggt
ggcgtgggatttgattatcgcctccacatggccattgctgataaatggattgagcttctc
cagaagaaggatgaagactggagaatgggtgacattgtacacactctcactaacagaagg
tggctggaaaagtgcgtttcatatgctgaaagtcatgaccaagctcttgttggtgacaag
accattgcattctggttgatggacaaggatatgtacgacttcatggctcttgatagacca
tcaactcctcttgtagatcgtggaatagcattgcacaaaatgatccggcttattaccatg
ggtttaggaggagaaggatatttgaattttatgggaaatgagtttggacaccctgagtgg
attgatttcccaaggggcgatcagcgccttcctactggtaaaattattccaggcaataat
aacagttttgataaatgccggcgtagatttgatctaggggatgcagaatatctaagatac
catggaatgcaagaatttgatcgggcaatgcagcatcttgaagaaatctatggtttcatg
acatctgagcaccaatatatatcacggaaaaacgaaggggatcgagttattgtcttcgaa
agagggaacttggtttttgtctttaattttcattggaccaacagttattcagattaccga
gtaggctgcttaaagccaggaaagtacaagattgttttagattctgatgatccattgttt
ggaggcttcaaaaggcttgataaggatgctgagtacttcagctcagaagggtggtatgat
gaccggcctcgttccttcctggtgtatgcaccaagtagaacggctgtggtctatgctctg
gtggaggatgaattggaacctgctgagggctga

DBGET integrated database retrieval system