KEGG   Populus trichocarpa (black cottonwood): POPTR_589596Help
Entry
POPTR_589596      CDS       T01077                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:pop03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 301 aa AA seqDB search
MNGLEGLILRLLEARSDRGKRIQLTEPEIRQLCVTAKQVFLAQPVLLELEAPINICGDIH
GQYPDLLRLFEYGGFPPDSNYLFLGDYVDRGKQSIETICLLLAYKIKFPDNFFLLRGNHE
CASINRIYGFYDECKRRFSVRLWKIFTDCFNCLPVAAVVDDKILCMHGGLSPEMDNLDQI
RAIERPADVPDQGILCDLLWADPDRNIKGWGDNDRGVSYTFGADKVAEFLKKHDLDLICR
AHQVVEDGYEFFADRQLVTIFSAPNYCGEFNNAGAFMWVDASLLCSFQILKPWRGREGHP
E
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaatggattggaagggcttatactcaggctgttggaagcaaggagtgatagagggaaa
cgcatccagctgactgaacctgaaatccgccaactttgtgtcaccgccaagcaagtcttt
cttgcacaacctgttcttcttgaattggaagctcccatcaatatctgtggtgatatacat
ggccaatatccagatctcttgcgattgtttgagtatggtgggtttccaccagattccaat
tatctatttcttggagactacgtagatagaggaaaacaaagtatagagactatatgcctt
ctccttgcctacaagatcaagttcccagacaactttttccttcttcgagggaaccatgaa
tgtgcttctatcaacagaatatatggattttatgatgagtgcaagcgtcgtttcagtgtc
cgtctatggaagattttcacagactgcttcaattgtttaccggtggctgcagttgtcgat
gacaaaatcctatgcatgcatggtggactctcaccagaaatggataacttggatcagatc
agagctatagaaaggccagcagatgtgccagaccagggtattctgtgtgacctcctttgg
gcagatcctgatagaaacatcaagggctggggtgataatgataggggtgtctcctacacc
tttggagccgataaggtcgctgagttcttaaagaaacatgacctcgatctcatatgccga
gcccaccaggttgttgaggatggctatgaattcttcgcagacagacagctggttaccata
ttctcagcaccaaactactgtggagagttcaacaatgcaggtgcatttatgtgggttgat
gcgagtttgctctgctcatttcagattctgaagccatggagaggtagagaagggcatcct
gaatag

DBGET integrated database retrieval system