KEGG   Populus trichocarpa (black cottonwood): POPTR_592725Help
Entry
POPTR_592725      CDS       T01077                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
pop  Populus trichocarpa (black cottonwood)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 482 aa AA seqDB search
MLTVSVKWLKEVFPKVEIDTSQPPYVFKCQLYDLTGVPPERQKIMVKGGLLKDDADWATV
GVKEGQKMMMMGTADEIVKAPEKGPIFMEDLPEEEQVVALGHTAGLFNLGNTCYMNSTVQ
CLHSVPDLKSALSNYPSQKSSDLDQTSHMLTAATRELFNELDKSVKPVAPMQFWMVLRKK
YPQFGQLHNGVYMQQDAEECWTQLLYTLSQSLRSPSPSQNPDTIKELFGIELVSRVHCQE
SGEESSETESVYSLKCHISQEVNHLHEGLKHGLKSELEKASPSLGRSAIYLKESCINALP
RYLTVQFVRFFWKRESNQKAKILRKVDYPLQLDVYDFCSDDLRKNLEAPRQILRDEEGKK
AGLKAKVKSSSSKDNDAKMTDVEGPSNESVKSSNSTSGEGGSSDKESHLTGIYDLVAVLT
HKGRSADSGHYVAWVKQESGKWIEYDDDNPIPQREEDITKLSGGGDWHMAYICMYKARAF
PV
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgttgacagtgagtgtaaaatggctaaaggaggtgtttccaaaagtggaaattgacaca
agccagcccccttatgttttcaaatgccagctgtatgatttgactggagtgccccccgag
aggcagaagatcatggttaagggtggtttgttgaaggatgatgctgattgggcaacggta
ggagtgaaggagggacaaaaaatgatgatgatgggcactgctgatgagattgtgaaggcc
ccagagaaaggccctatttttatggaagatcttccagaagaagaacaagtggttgctctg
ggccacactgctggcctctttaatctagggaacacttgctacatgaactcgacagtacaa
tgcttgcattctgttccagacttgaagtctgctttatccaactatccatctcaaaaaagc
agtgatctggatcagacatctcatatgctgacagctgcaactcgagaactatttaatgaa
ctcgataaaagtgtcaagcctgtggcacctatgcagttctggatggtattgcgcaaaaag
tatccacaatttggccagttgcataatggagtctacatgcagcaggatgctgaagaatgt
tggacacagcttttatacaccctctcacagtcacttagatcaccgagtcccagtcaaaat
ccagatacaattaaggaactttttggcattgaacttgtaagcagggtacattgccaagaa
agtggtgaagaaagctcagagacagaatcagtttactcactgaagtgccacatatctcaa
gaggtgaaccatttgcatgaaggactgaagcatggtttgaagtctgaattggagaaggct
tctccttccttgggccgtagtgcaatttacctgaaagagtcctgtattaatgccttgcca
aggtacctaactgttcaatttgttcgttttttctggaagagggaatcaaatcaaaaggct
aagattttacggaaagtggattacccattgcaactggatgtatacgatttttgctcagat
gatcttcgcaaaaatttagaagcacctcgccagattttaagagatgaggagggtaaaaag
gctggtttgaaagccaaggtgaagagctctagctcaaaggacaatgatgccaagatgact
gatgtggagggaccatcaaatgagagtgtaaaatcatcaaattctacctctggagaaggt
ggttcttcagacaaagaatcacatttaactggaatatatgatttggttgctgtgcttacc
cataagggaaggagtgctgattcagggcattatgttgcatgggtcaagcaagaaagtggg
aaatggattgagtatgatgatgataatcctattccacaacgagaggaagatataactaag
ctctctggaggaggtgattggcatatggcatacatttgtatgtacaaggcacgagctttc
ccagtgtaa

DBGET integrated database retrieval system