KEGG   Populus trichocarpa (black cottonwood): POPTR_592888Help
Entry
POPTR_592888      CDS       T01077                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pop00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pop00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pop00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pop00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 469 aa AA seqDB search
MATDTAKISQLKSAVANLNQISESEKTGFVNLVSRYLSGEAQQVEWSKIQTPTDEVVVPY
DTLAPTPEDPEETKKLLDKLVVLKLNGGLGTTMGCTGPKSVIEVRNGLTFLDLIVIQIEN
LNKKYGCSVPLLLMNSFNTHDDTQKIVEKYSNSNIEIHTFNQSQYPRLVVDDFVPLPSKG
HTDKDGWYPPGHGDVFPSLKNSGKLDALLSKGKEYVFVANSDNLGAVVDLKILNHLIRNK
NEYCMEVTPKTLADVKGGTLISYDGKVQLLEIAQVPDQHVNEFKSIEKFKIFNTNNLWVN
LKAIKRLVEADALEMEIIPNPKEVDGVKVLQLETAAGAAIKFFDHAIGINVPRSRFLPVK
ATSDLLLVQSDLYTLVDGFVIRNPARTIPANPSIDLGPEYKKVANFLSRFKSIPSIIELD
SLKVVGDVWFGAGITLKGKVSIVAKSGVKLEIPDGAVLQNKEINGPEDL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggctactgatacggccaagatctctcagctcaaatcagctgttgctaatctcaatcaa
atcagcgagagtgagaaaactggattcgtcaacctcgtttctcgctatctcagtggggaa
gcgcagcaagttgagtggagtaagattcagacacctactgatgaagtagtggttccttat
gataccttggcgccaactccggaggatccggaggaaacaaagaagcttttggacaagctt
gtcgttttgaagcttaatggaggtttggggactacaatgggatgcactggtcctaagtct
gtcattgaagttcgtaatggattgacatttcttgaccttattgtcatccagatcgagaat
cttaataagaaatatgggtgcagtgttcccttgcttctaatgaactcattcaacactcat
gatgatacacagaagattgttgagaagtactcgaactcaaatattgagattcacactttt
aatcagagccaataccctcgtctggttgttgatgattttgttccattgccttccaaagga
catactgacaaggacggatggtatcctcctggacatggtgatgtgttcccatccctaaag
aacagtggcaaacttgatgctttattgtcgaagggtaaagagtatgtgtttgtcgccaac
tcagacaacctcggcgctgttgttgatttgaaaatcttaaatcatctgatcagaaacaag
aatgaatactgcatggaggtgacacccaaaaccctggctgatgtgaagggtggtactctc
atctcttatgatgggaaggttcagctcctggaaattgctcaggtccctgatcagcatgtt
aatgagttcaagtcaatcgagaagttcaaaattttcaatacaaacaacttgtgggtgaac
ttgaaagcaattaaaaggcttgtggaagcagatgcacttgagatggagatcattccaaac
ccaaaggaagtagatggagtcaaagtacttcagctagaaactgcagctggagcagcaatt
aagtttttcgatcatgcaattggtataaatgtacctcgttctcgattccttccagtgaag
gcaacttcagatctgcttcttgttcagtctgatctttacactttagttgatggttttgtc
atccgaaatccagctcgaacaattcctgcaaatccttctattgatctgggaccagagtat
aagaaggttgccaacttcttgagccgatttaaatcgatccctagcattattgagcttgat
agtctaaaggtggtcggtgatgtatggtttggtgctggtattactctcaaggggaaagtg
agtatcgtggcaaaatctggtgtgaaattggaaataccagatggagctgttcttcaaaac
aaggaaatcaatggcccggaggacctctaa

DBGET integrated database retrieval system