KEGG   Populus trichocarpa (black cottonwood): POPTR_645149Help
Entry
POPTR_645149      CDS       T01077                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:pop03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 145 aa AA seqDB search
EKLDPLAEKLRQQRLVEEADFRSTTELFAKKGDVKSLDSFIPKSESDFLEYAELISHKLH
SFEKSYHYIGLLKAIMRLSMTAMKAADAKVSASVSAIANEKIKAEKEATVSKKKQAGKKK
QLHVDKPEDDLVVNPYDALDDVDFM
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
gagaaactagatccactagctgagaaacttcgccagcaaaggctggtggaagaagctgat
ttcagatccactacagaactgtttgctaagaaaggtgatgtgaaatcgcttgatagtttc
ataccaaaatctgaaagtgacttcttggaatatgcagaacttatttcacataagcttcac
tcatttgagaaaagttaccattatatcggtttacttaaggcaataatgagactgtccatg
actgccatgaaagctgcagatgcaaaagtttcggcctctgttagtgcaattgcaaatgaa
aagataaaagctgagaaagaagccaccgttagcaaaaagaagcaagctgggaagaaaaaa
cagcttcatgttgataagcccgaagatgatttggtggttaatccctatgatgctctcgat
gatgttgattttatgtaa

DBGET integrated database retrieval system