KEGG   Populus trichocarpa (black cottonwood): POPTR_679877Help
Entry
POPTR_679877      CDS       T01077                                 

Definition
hypothetical protein
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.1.2.15]
Organism
pop  Populus trichocarpa (black cottonwood)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 289 aa AA seqDB search
MLEDGNCLFRAVTDQVYGDSEMYDLARQMCVDYMERERDHFSQFITEGFTSYCKRKRRDK
VYGNNVEIQALSEMYNRPIHIYSYSTEPINIGSYNTDTPPIQLSYHHGNHYNSLVNPRRS
TIGAGLGFSCLQGASVDRDQVKAAIKAQQDQQIDNALLAEGQFYSDLEVTEKEIERMVME
ASRAEYLADNKFKPQLGRKGSSTSGAEPSSSGARSSSASETTKVEGAREHGSQDTVLSSS
MQIVLSMGFSYLQAIEAYSIFGDDVDSMVCYLVETSSSSSSRRKGKATE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgttggaggatgggaattgtctcttccgtgctgtgacagatcaagtttatggggattct
gaaatgtatgatttggccagacaaatgtgcgtggactatatggaaagggaaagggatcac
ttttctcaattcattactgaaggttttacatcttactgtaagaggaagagaagagacaag
gtgtatggaaacaatgtggagatccaagctttatctgaaatgtacaatcgaccaatccac
atttattcctatagcaccgaacccatcaacattgggagctacaatacagacacacctccc
atacagctaagctatcatcatggtaatcattacaactctcttgtcaacccacgccgctca
acaattggtgcaggacttggtttcagctgtcttcaaggggcaagtgtggatagagatcag
gtcaaagctgctattaaagctcaacaagaccagcagattgataatgcacttctggctgag
gggcagttttactctgatcttgaggttactgagaaggagatcgaacgcatggtgatggaa
gcttctagagctgagtatcttgctgataacaagttcaaaccacaacttggccgtaaagga
tcttctacttctggtgcagaaccatcatcttctggcgctagatcatcatcggccagtgag
actactaaggtggaaggtgcaagagaacatggctcacaggatactgtccttagcagcagt
atgcagatcgtgctgtcaatgggattcagttacctgcaagcaatcgaggcctacagcata
tttggtgatgatgtggattccatggtttgttacctcgtggaaaccagcagcagcagcagc
agcagacgcaaaggcaaggcaactgaatga

DBGET integrated database retrieval system