KEGG   Populus trichocarpa (black cottonwood): POPTR_725114Help
Entry
POPTR_725114      CDS       T01077                                 

Gene name
HTB912
Definition
histone H2
Orthology
K11252  
histone H2B
Organism
pop  Populus trichocarpa (black cottonwood)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 140 aa AA seqDB search
MAPKAAEKKPAEKKPAAAEKAPAEKKPRAEKKIPKEGAIDKKKKRSKKNVETYKIYIFKV
LKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQTAVRLVLPG
ELAKHAVSEGTKAVTKFTSS
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaaggccgcagagaagaagccggctgagaaaaagccagcggcggcagagaaa
gccccagcggagaagaagccaagggcagagaagaagatacccaaagaaggagcgattgac
aagaagaagaagaggtcaaagaagaacgtcgagacctacaagatctatatctttaaggtc
ctgaaacaggtccatcctgacattgggatctcaagcaaggcaatgggtatcatgaacagt
tttatcaacgatatctttgagaaactcgctcaagaggcttcaaggctcgctaggtataac
aagaagcccaccattacttctcgggagatccagactgctgtcagattggttttgcctgga
gagcttgcgaaacatgctgtttctgaagggaccaaggctgttaccaagtttacaagctct
tag

DBGET integrated database retrieval system