KEGG   Populus trichocarpa (black cottonwood): POPTR_744493Help
Entry
POPTR_744493      CDS       T01077                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:pop03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:pop03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 334 aa AA seqDB search
MADFQSSSHKAKWIFTPQQLAEKYKATNNRAKQMLEKYGTTRMRVDVDGSLSYPEPQVNM
TENADKHSRSKPISVEEEQFMRVYYEYKLREVCSAFYFPHKIQATALLYFKRFYLQWSVM
EHDPKHVMLTCIYAACKIEENHVSAEELGKGISQDHQMILNYEMIVYQAWSLEFDLIVYA
PYRSVEGFVADIEEFCHPTDENIEKLKEIAVAEIDKIMLTDAPVMFPPGQLALAALQSAN
EVHRVLDFERYLESVLSRQNSAHMISEISESLHAVEKWVRKYSFPTDKDMKHINRKLKSC
WGHNSHDDNKKREKKSKHKSHKSSNEMQNGPGLT
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggccgatttccaatcctcaagtcacaaagccaagtggatcttcacccctcaacagttg
gccgagaaatataaagctactaataatagagcgaaacaaatgttagagaagtatggaacg
acaagaatgagagtagatgttgatggttcattgtcatatccagaacctcaagttaacatg
acagagaatgctgataagcattctcgttcaaaaccaataagtgttgaggaagaacaattt
atgcgagtatactatgagtataaacttcgagaagtgtgtagtgcattctattttcctcat
aaaattcaggcaactgcactcctatactttaaaaggttttatcttcaatggtcagtcatg
gagcatgatccaaaacatgtaatgttaacctgcatctatgcagcatgcaagatagaagaa
aatcatgtgtctgcggaggagcttggtaaggggatttcacaggatcatcaaatgattctc
aattacgagatgatagtttatcaggcatggagtttggaatttgatcttattgtctatgca
ccatatcgatctgttgaaggttttgttgctgatatagaggaattctgccatccaacagat
gaaaatattgaaaagctgaaggaaattgcagtggcagagattgacaaaatcatgctcact
gatgcacccgttatgttccctcctgggcagttggcattggctgctctgcagagtgcaaat
gaggtgcatagagttcttgattttgagagatatctcgagagtgtcctctctcgtcagaat
tctgcacacatgatttcagagatcagtgaatctctacatgccgtcgagaaatgggtgagg
aaatacagtttccctacggataaggatatgaagcacataaatcggaagctgaaatcatgc
tggggtcataactcacacgatgacaataagaaaagggagaagaaatcaaaacacaagtcc
cataagagttcgaatgaaatgcaaaatggcccaggactgacttaa

DBGET integrated database retrieval system