KEGG   Populus trichocarpa (black cottonwood): POPTR_748952Help
Entry
POPTR_748952      CDS       T01077                                 

Definition
hypothetical protein
Orthology
K05582  
NAD(P)H-quinone oxidoreductase subunit K [EC:1.6.5.3]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NAD(P)H:quinone oxidoreductase, chloroplasts and cyanobacteria
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:pop00190]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 225 aa AA seqDB search
MNSIEFPLLDRTTPISVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFASLIGSRFDFDR
YGLVPRSSPRQADLILTAGTVTMKMAPSLVRLYEQMPEQKYVIAMGACTITGGMFSTDSY
STVRGVDKLIPVDVYLPGCPPKPEAIIDAITKLRKKISREIYEDRIRSQQGNRCFTTNHK
FHIGRTTNTGNYDQGLLYQPPSTSKIAPEAFFKYKKSVSSPELVN
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaattccattgagtttcccttacttgatcgaacaaccccaatttcagttatttcaact
acatcaaatgatctttcaaattggtcaagactctccagtttatggccgcttctctatggt
accagttgttgcttcattgaatttgcttcattaataggctcacgattcgactttgatcgt
tatgggctagtaccaagatctagtcctagacaagcggacctgattttaacagccggcaca
gtaaccatgaaaatggctccttctttagtgagattatatgaacaaatgccggaacaaaaa
tatgttattgctatgggagcatgtacaattacagggggaatgttcagtacggattcttat
agtactgttcggggagtcgataagctaattcctgtagatgtctatttgccgggctgccct
cctaaaccggaggcgattatagatgctataacaaaacttcgtaaaaaaatatctcgagag
atttatgaagatcgaattaggtctcaacaggggaatcggtgttttactaccaatcacaag
tttcatattggacgtactactaatactggaaattatgatcaaggattactctatcaaccg
ccgtctacttcaaaaatagctcctgaagcctttttcaaatacaaaaagtcagtatcgtcc
cctgaattagtaaattag

DBGET integrated database retrieval system