KEGG   Populus trichocarpa (black cottonwood): POPTR_791419Help
Entry
POPTR_791419      CDS       T01077                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pop  Populus trichocarpa (black cottonwood)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 238 aa AA seqDB search
MQLLRGLKYLHSANILHRDLKPGNLLINANCDLKICDFGLARTSNGNNQFMTEYVVTRWY
RAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFPGTECLNQLKLIINILGSQSEEDLE
FIDNMKAKKYIKSLPYSPGTPFSHLYPNAHPLAIDLLQKMLIFDPSKRITVTGALEHPYM
SPLYDPSCNPPAQVPIDLDIDEELGEEMIREMMWKEMLLYHPEAAAANGEVCAPNLVC
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgctacgtggtctgaaatatcttcactcagcaaatattctccatcgtgacttg
aagcctggaaaccttctcatcaatgcgaactgtgacctaaaaatctgtgattttgggctg
gcacgcactagcaatggcaacaaccagttcatgactgagtatgttgtcactcgttggtat
cgtgctccagagctccttctatgctgtgataattatgggacatcaattgatgtctggtct
gtaggatgcatctttgcagagcttctaggtcggaagcctatcttccctggcacagaatgt
ctcaatcagcttaaacttatcatcaacatcctcggaagtcaaagtgaggaggatcttgaa
tttattgataacatgaaggcaaagaaatatatcaagtcacttccttattcacctgggact
cccttttcccacctttatcctaatgcacatcctttggcaattgatctgctacaaaaaatg
cttatttttgacccatcaaagaggatcactgtcactggagcactggaacacccttacatg
tctccactatatgatcccagctgcaaccctccagctcaggtcccaattgatcttgacata
gatgaggaattgggggaagaaatgatacgagagatgatgtggaaggagatgcttctttac
catcctgaggctgcagcggccaatggtgaggtgtgtgctcctaatctcgtctgttaa

DBGET integrated database retrieval system