KEGG   Populus trichocarpa (black cottonwood): POPTR_810168Help
Entry
POPTR_810168      CDS       T01077                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pop00561]
Organismal Systems; Environmental adaptation; Plant-pathogen interaction [PATH:pop04626]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 519 aa AA seqDB search
MAKTKEAAFIGSIDQGTSSTRFIIYDRNSRCVGSHQVEFTQLYPQAGWVEHDPMEILESV
KVCMAKAVDNASAEGHNVDAALKAIGLTNQRETTLVWSKSTGRPLYNAIVWMDVRTTSVC
RRLEKEMPGGRTHFVETCGLPISTYFSAMKLIWLMENVDAVKEGIKKKDALFGTVDSWLI
WNLTGGVKGGLHVTDVSNASRTMLMNLKTLEWDKPTLETLKIPAEILPKIISNSEIIGKI
TEGWPLVGFPIAGCLGDQHAAMVGQACKKGEAKSTYGTGAFILRNTGEEVVNSTHGLLTT
LAFKLGSKAPANYALEGSIAIAGAAVQWLRDSLGVIKSAGEIEELASQVDTTGGVYFVPA
FNGLFAPWWRDDARGVCIGITRFTSKAHIARAVLESMCFQVKDVLDSMHKDAAGSEEGEF
LLRVDGGATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGVWTEEEIFASGE
KSKSDTTFRPKLNEELRKKKVDSWFKAVERTFDLADLSI
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaacaaaggaggctgccttcattggctccattgatcaaggcacaagcagcacc
agattcatcatctatgaccgtaactctcgctgtgttggatctcaccaggttgagttcacc
cagctctatcctcaagccggatgggtggagcatgacccaatggaaatactggagagtgtg
aaggtgtgcatggcaaaggcagtggacaatgcttcggcagaggggcataatgtggacgct
gctttgaaggctattggtttgaccaatcagagagaaactactcttgtttggagcaaatcc
actggtcgtcccctctataatgccattgtttggatggatgttcgcaccacttctgtttgc
aggaggctggagaaagaaatgccaggaggaaggactcatttcgttgagacatgcggattg
ccaattagcacttatttcagtgccatgaagttaatctggttgatggaaaatgtggatgcg
gttaaagagggtatcaagaagaaagatgctttgtttggaacggtagattcttggttgatc
tggaatttaactggcggagtaaagggtggcttgcatgtgactgatgtctctaatgcatct
cgaactatgctcatgaatcttaagactcttgaatgggataaacctacattagaaaccctg
aaaatcccagctgaaattcttccaaaaattatcagtaattctgagattattggaaagatc
acagagggatggccgcttgttggtttcccaattgctggatgtcttggtgaccaacacgct
gcgatggttgggcaagcttgtaaaaagggtgaggctaagagcacttatggaactggtgct
ttcatacttcgcaacacgggtgaggaggtggtaaattcaacgcatgggcttctaaccacc
ttggcatttaagcttggctcaaaagcgccagcaaactatgcacttgaaggctcaattgct
attgctggggctgcagttcaatggctcagagatagtcttggagtaattaaaagcgctggt
gaaattgaggaactggcatctcaggttgacacaactggtggggtttattttgttcctgcc
ttcaatggattgtttgctccatggtggcgtgatgatgctcgtggggtttgtattgggatc
acaaggtttacaagcaaggctcacattgctcgagctgtgcttgagagcatgtgttttcaa
gtgaaggatgtgttagattcaatgcataaagatgccgctggttctgaagagggagaattc
ttgcttagagtggatggtggtgctactgtcaacaacctcttgatgcagattcaggctgac
ttgctagggagccctgtggtgagacctgctgatattgagacaacagccctcggagcagcc
tatgctgctggtttagctgtcggggtttggacagaagaagagatttttgcttctggagaa
aagtccaagtctgacaccactttccgtcccaaactaaatgaggagctgaggaagaagaag
gtggattcgtggttcaaagctgttgaaaggacttttgacttggctgatctttccatttga

DBGET integrated database retrieval system