KEGG   Populus trichocarpa (black cottonwood): POPTR_836268Help
Entry
POPTR_836268      CDS       T01077                                 

Definition
hypothetical protein
Orthology
K08232  
monodehydroascorbate reductase (NADH) [EC:1.6.5.4]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Ascorbate and aldarate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:pop00053]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 434 aa AA seqDB search
MAEKSFKYVIIGGGVSAGYAAREFCKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGT
ARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVKADLAAKTLVSAAGEIFKYHILII
ATGSTVIKLTDFGVQGADAKNILYLREIDDADKLVEAIKGKKNGKAVIVGGGYIGLELSA
ALRINNIDVTMVYPEPWCMPRLFTAGIAAFYEGYYANKGVKIVKGTVAVGFNADSNGEVK
EVKLKDGRVLEADIVVVGVGGRPLTTLFKGQVEEEKGGIKTDAFFKTSISDVYAVGDVAT
FPLKLYNDIRRVEHVDHARKSAEQAVKAIKSNEEGKTIDVYDYLPFFYSRSFDLSWQFYG
DNVGDAVLFGDNDPASPKPKFGSYWIKDGKVVGVFLEGGTPDENKAIAKVARVQPPVENL
DVLTKEGLSFACKI
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaagagcttcaagtatgtgatcatcggcggtggtgtatctgctggatacgct
gctagagagttttgcaagcagggggttaagcccggtgagcttgcaatcatctccaaggag
gcggtggctccttatgaacgtcctgcactgagcaaggcttatctttttcctgagggaact
gcaagacttccaggattccatgtctgtgttggaagtggaggggagagattacttcctgag
tggtacaaagagaaagggattgagttgatccttagcacagaaatagtgaaagcagatctt
gctgccaagacacttgttagtgcagctggagaaatattcaagtatcatattttgattatt
gcaactggttccacagtcattaagttgacagattttggtgtccaaggagctgatgccaaa
aacattctctacttgagagaaattgatgatgctgacaaacttgtagaagcaattaaagga
aagaagaatggaaaggctgtaattgttggaggaggatacattggtcttgaacttagtgca
gctttaagaatcaacaatattgatgttacaatggtttatcccgaaccatggtgcatgcct
cgcctttttactgctggtatagctgccttctatgagggttattatgctaacaaaggagtc
aagatcgttaagggaacagttgctgttgggttcaatgctgattcaaatggagaggtaaag
gaagtgaaactaaaggatggcagggtgctagaagctgacattgttgttgttggtgttggt
ggaaggcctcttacaacactatttaaagggcaggttgaagaggagaaaggtggaataaag
actgatgcgtttttcaaaactagtatttctgatgtatatgctgtcggtgatgtcgccaca
tttcctttgaagttgtacaatgatatcagaagagttgaacatgttgaccatgcccgtaaa
tcagctgagcaggctgtgaaggccatcaagtcaaatgaagaggggaaaacaattgatgta
tatgattaccttccattcttctattctcgttcctttgatctgtcctggcaattctacggt
gacaatgttggtgatgccgtgctatttggagacaatgatccagcatcacccaagccaaag
tttggatcatactggatcaaagatgggaaggttgtcggagtttttctggagggtggaact
cccgatgagaataaagcaattgccaaggttgctagggtccagcctcctgttgagaatttg
gacgtgctgacaaaagaaggtctttctttcgcctgtaagatatga

DBGET integrated database retrieval system