KEGG   Populus trichocarpa (black cottonwood): POPTR_836951Help
Entry
POPTR_836951      CDS       T01077                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pop  Populus trichocarpa (black cottonwood)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 213 aa AA seqDB search
MGCFSSKVARQFPGHEDPVALASQTAFSVSEVEALFELYKSISSSVVDDGLISKEEFQLA
LFKNRKKENLFANRIFELFDVKHKGVIDFSDFVRSLNVFHPNASQEDKIDFSFKLYDLDN
TGFIERQEVKQMLIALLCESEMKLADETVEIILDKTFLDADVNRDGKIDKSEWENFVCRN
PSLLKIMTLPYLRDITTTFPSFVFNSEVDEIAT
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgggctgttttagttctaaagtagcaagacagttccctggacacgaggaccctgttgcc
cttgcctcacaaacagcttttagtgtgagtgaagttgaagcactttttgaactatacaag
agcattagcagttccgtggttgatgatgggttaataagcaaggaagagtttcagttggct
cttttcaaaaacagaaagaaagagaatctctttgcaaataggatttttgagctgtttgat
gttaagcacaagggagtcattgatttcagtgattttgttagatcactcaatgtcttccat
cccaatgcctcacaagaagacaagatagacttctcatttaaactatatgatctggataac
acgggattcattgagcgccaagaggttaagcaaatgttgattgcacttctctgtgaatcg
gaaatgaagttggctgatgagactgttgagataattcttgataagactttcttggacgct
gatgtaaatagagatgggaagatagacaagtctgagtgggagaactttgtttgtagaaac
ccatccttattaaagataatgactctcccctacttgagggacatcacaacaacgtttccg
agttttgtctttaattctgaggtggatgagattgctacatag

DBGET integrated database retrieval system