KEGG   Populus trichocarpa (black cottonwood): POPTR_917649Help
Entry
POPTR_917649      CDS       T01077                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pop00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 296 aa AA seqDB search
MAPPVSPFSLAPSLSSSSSCLQLHRRFFSPSLRTSASASSTSNSAPKVVVTRERGKNGKL
IKALAKYGISCLELPLIQHTQGPDSDKLSSVLCADSAFDWIIVTSPEAGSVFLEAWKVAG
TPKVKLGVVGAGTASIFEEVMQSSERSLDVAFTPSKATGKVLASELPRNGNKRCTVLYPA
SAKASNEIEQGLYNRGFEVVRLNTYTTVPVGHVDEMVLKQAISAPVVAVASPSSVRAWAN
LIPESEEWNNSVACIGETTGSAAKRLGFKKVYFPRQPGLEGWVDSILEALRAHNDS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaccagtctctcccttctctctcgctccttcactttcttcttcttcttcgtgc
ctgcaacttcaccggcgatttttctctccgtctcttagaacctcagcttctgcatcttct
acttcgaattcagcgcccaaagtcgtagtcactagagaacgaggcaaaaacggcaagctc
attaaagctctggcgaaatatgggataagttgtttggagcttccactgattcagcataca
cagggacctgattcagataaactatcttctgtgttatgcgcagatagtgcgtttgactgg
atcattgtaacttcccctgaagcaggctctgtctttctggaggcatggaaggtagctgga
accccaaaagttaagctaggggttgtaggagctggcacagcaagcatttttgaggaagta
atgcaatcatcagagagatcacttgatgttgcctttacaccatcaaaagcaactggtaag
gttttggcatcagagcttccaaggaatggaaacaaaagatgcactgtattgtacccagct
tctgcaaaagcaagcaatgagatcgaacaaggtctgtataatcgtggatttgaggttgtc
agactaaatacatacacaactgtgcctgttggtcatgttgatgaaatggttctgaagcag
gcaatttcagcccccgttgttgcagttgcttcaccttcttcagttcgagcctgggccaat
cttattccagaatcagaggaatggaacaattcagtggcctgtattggggagacaactgga
tcagcagcaaaaagattaggttttaaaaaagtgtactttccaagacaacctggtcttgaa
gggtgggtagatagcatccttgaggccttaagagcacacaacgattcctag

DBGET integrated database retrieval system