KEGG   Populus trichocarpa (black cottonwood): POPTR_929965Help
Entry
POPTR_929965      CDS       T01077                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pop00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:pop00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:pop00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:pop00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:pop00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 582 aa AA seqDB search
MTSNLVISSRCSLFLTLFYLLVSASLTATSAQWVWPKPRTLSWPIPLATILSPNFTISSP
YHQHLSPAVNRYRLQILTEHHLPLVPPPFNLSNSSPPLQALTITVKDLAAPLQHSVDESY
ALAIPTASSTANLTAETVWGAMRGLETFSQLVWGLKPLLVPVGLDVWDSPLFEHRGIILD
TSRNYYPVDDILRTIKAMSANKLNVFHWHITDSHSFPLVLPSEPALADKGSYGNDMLYSP
ADVATIVRFGLEHGVRVLPEIDSPAHTGSWAEAYPDIVTCANMFWWPAESKWADRLASEP
GTGQLNPLNPNTYQVLKNVIGDAVALFPEPFFHAGGDEIIPGCWKADPAIQSFLSKNGTL
SQLLEKFVNSTFPYIVSLNRTVVYWEDILLDANVKVDPSFLPPEHTILQTWNNGPNNTKL
IVSSGYRAIVSSSEFYYLDCGHGGFLGNDSQYDPPPTSGGSGNGGSWCAPFKTWQTIYNY
DIAYGLTPEETKLVLGGEVALWSEQADPTVLDVRIWPRASAMAETLWSGNRDESGKKRYA
EAMDRLNEWRHRMVNKGIRAEPLQPLWCIKNPGMCNTVHPSD
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtaacttggtaataagcagccgctgttccttattcttaacgttgttttacttg
ctggttagtgcctcccttacagcaacatcagctcaatgggtatggccgaagccaagaacc
ctgtcttggccgatcccactcgccactattctctccccaaacttcactatctcctccccc
taccaccaacatctctccccagccgttaaccgttaccgcctccaaatcctcacggaacac
cacctccctctcgttcctcccccattcaacctctccaactcatcccctcctttgcaggcc
ctgaccatcactgtcaaagacctcgccgccccactccaacactccgttgacgagtcctac
gcccttgccatccccactgctagctccaccgccaatctgacggccgagactgtatggggc
gcaatgaggggtctggagacgttttctcaactggtttggggattgaaaccattgcttgtc
cctgttgggctcgacgtgtgggactcgcctctgtttgagcatagagggatcattttggat
acctctaggaattactacccagtggatgacattttgaggaccatcaaagccatgagtgct
aataagctcaacgttttccattggcacattaccgattctcactcttttcctttagtgctt
ccatctgagcctgctcttgctgacaaagggtcttatgggaatgacatgctctactctcca
gctgatgttgcaacaattgttcggtttggtttggagcatggcgtcagggtactaccggaa
attgattctccagcacatacaggatcgtgggctgaagcctatccagatatcgtgacttgc
gcaaacatgttctggtggccggctgaaagcaaatgggctgaccggcttgcatcagaacca
ggaactggccagctaaatcctttgaacccaaatacctaccaagttctaaaaaatgtgatt
ggtgatgcagttgccttgtttcctgaaccgtttttccatgctggaggtgatgagatcatc
ccaggctgttggaaagctgacccggccattcagtccttcctatccaaaaatggaactctc
agtcaactccttgagaaatttgtgaactcaaccttcccttacattgtgtccctcaatcgc
acggtggtttactgggaagatattttgttggatgccaatgtcaaggtggacccttcattt
cttccacctgagcataccatcctacagacatggaataacggtcccaacaacacgaaactg
attgtttcttctggttacagagctattgtctcatcctcagagttttattatttggattgt
ggacatggtggttttcttgggaatgacagccaatatgatccaccaccaacaagtggtggc
agtggcaatggtggatcatggtgtgcacctttcaaaacatggcaaaccatatataactat
gacatagcatatggattgactccggaggagaccaaattggtgctagggggtgaagtagca
ttatggtcagagcaagcagatccaacagttttggacgtgcggatttggccaagagcttca
gcaatggctgagactttatggtcagggaacagagatgagtcaggcaagaagaggtatgca
gaggcaatggatcgtttaaatgagtggagacatagaatggtcaacaaaggaatcagagct
gaaccactgcagcctctctggtgcatcaagaaccctggcatgtgcaacacagttcatcca
agtgattag

DBGET integrated database retrieval system