KEGG   Porphyrobacter sp. LM 6: BG023_11766Help
Entry
BG023_11766       CDS       T04468                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
porl  Porphyrobacter sp. LM 6
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:porl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BG023_11766
   00630 Glyoxylate and dicarboxylate metabolism
    BG023_11766
   00640 Propanoate metabolism
    BG023_11766
   00650 Butanoate metabolism
    BG023_11766
  Lipid metabolism
   00071 Fatty acid degradation
    BG023_11766
   00072 Synthesis and degradation of ketone bodies
    BG023_11766
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BG023_11766
   00310 Lysine degradation
    BG023_11766
   00380 Tryptophan metabolism
    BG023_11766
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BG023_11766
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BG023_11766
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BG023_11766
Enzymes [BR:porl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BG023_11766
Exosome [BR:porl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BG023_11766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
772764..774032
Genome map
AA seq 422 aa AA seqDB search
MAEAYIIDAVRTPRGIGKQGKGALAACHPQHLAATVLKAIKDRNNLDTKTVDDVIWSVST
QDGMQAGDMGRMAALDAGYDITSSGTTLDRFCGGGITSVALAAAQVMSGMEDCVVAGGTE
MMSLTAAMSQEKMRAGIKPPMMGSYNQRLQKVHPQSHQGICGDAIASKEGFTREELDEVG
YRSQVRAAEAIAEGRFAKSVVPVVADDGTVLLDHEEYPRPQTTMEDLAKLEPAFPKIADV
PLDEAGTTFRKLINQKYPDLEIKHFHHAGNSSGVVDGAAAVLITSKAYAEKHGLKPRARI
VATANMGDDPTLMLNAPVPAAKKVLAKAGLTTEDIDLYEINEAFAVVAAKFVRDLGLSWD
NVNVNGGSIALGHPIGATGSILIGTVVDELERRGGRYGLVTMCAAGGMAPAIIVERVDGF
VD
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagcttacatcatcgacgctgtccgcaccccgcgcgggatcggcaagcagggc
aagggcgcgctggccgcgtgccacccgcagcatctggccgccacggtgctcaaggcgatc
aaggaccgcaacaacctcgacaccaagaccgtcgatgacgtgatctggtcggtcagcacg
caggacgggatgcaggcgggcgacatgggccgcatggccgcgctcgacgcgggctatgat
atcacctcgtccggcaccacgctcgaccgcttctgcggcggcgggatcaccagcgtcgcg
ctcgccgccgcgcaggtgatgagcggaatggaagattgcgtcgtcgccggcgggacggag
atgatgagcctcaccgccgccatgtcgcaggagaagatgcgcgccgggatcaagccgccg
atgatgggcagctacaaccagcgtctccagaaggtgcacccgcagtcgcaccaggggatt
tgcggcgatgcgattgcctcgaaggaaggcttcacccgcgaagagctcgacgaagtcggc
tatcgctcgcaggtgcgcgcggccgaagccatcgccgaaggccgcttcgccaaatcggtg
gtgccggtggtggctgacgatggcacggtgctgctcgatcacgaggaatatccgcgcccg
cagaccacgatggaagacctcgccaagctggagccggccttccccaagatcgccgacgtt
cctctggacgaggctggcacgaccttccgcaagctgatcaaccagaagtatcccgatctc
gagatcaagcacttccaccacgcgggtaactcctcgggcgtggtcgatggcgccgctgcg
gtgctgatcacctccaaggcctatgccgaaaagcacgggttgaagccgcgcgcgcgcatc
gtcgccaccgccaacatgggcgatgatccgacgctgatgctcaacgcgccggtgccggcg
gcgaagaaggtgctggccaaggctggcctcaccaccgaggacatcgatctttacgagatc
aacgaggctttcgccgtcgtcgccgcaaagttcgtgcgcgacctcgggctgagctgggac
aacgtcaacgtcaacggcggctcgattgcgctgggtcacccgatcggcgcgactggttcg
atcctgatcggcacggtcgtggacgaactcgagcgtcgcggtggccgctatggcctcgtc
accatgtgcgcggcgggcggcatggctccggcgatcatcgtcgagcgcgtcgacggcttc
gtcgactga

DBGET integrated database retrieval system