KEGG   Onion yellows phytoplasma OY-M: PAM_170Help
Entry
PAM_170           CDS       T00154                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
poy  Onion yellows phytoplasma OY-M
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:poy01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:poy01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:poy00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:poy00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
200974..201798
Genome map
AA seq 274 aa AA seqDB search
MNYKPRTKVIAGNWKMYKCKDEALEFIQKVSLQVPDQTQVQTLIFPQLTLLDSLAQLQGT
NLQVGAQNMFYESEGAFTGEVSPQNLLSLGVKHVLLGHSERRTFFGETDQTVNLKLLSAL
KHKLVPTVCVGESLLTKENNQTQVFLDQQLTNIFAGVPEEALQNIIIAYEPVWAIGTGKS
ATPQDANKVIEQIRDKVTALYSSQASCAMRIIYGGSVSVANIKTILEQPAIDGILAGKAS
LQTEDFLFFAQIASKQALASTKDIFQKNDCPFCC
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaattacaaaccaagaacaaaagtgattgcaggtaattggaaaatgtacaaatgcaaa
gacgaagccctggaattcatccaaaaagtaagcttgcaagttcctgaccaaacccaagtc
caaactttaattttcccccaacttaccttattagattccttagcacaactccaaggcact
aatttacaagtaggggcccaaaatatgttttatgaatccgaaggcgcttttactggcgaa
gtttcaccacaaaatttgctttcattaggtgtcaagcacgttttattaggacacagcgaa
agaagaactttttttggagaaaccgatcaaacagttaatctaaaacttttatcagctctc
aaacacaaattagttcctactgtttgtgtgggcgaatcgcttcttaccaaggaaaataac
caaacccaagtttttttagaccaacaattaaccaacatttttgcaggtgttccagaagaa
gcattacaaaacatcatcatcgcttatgaaccggtttgggcaattggtacaggcaaaagt
gcaactccccaagatgctaacaaagtcattgaacaaatcagagacaaagtcactgcactt
tattcttcccaagcatcttgtgccatgagaattatttacggcggttcagtgtctgttgcc
aacattaaaaccattttagaacaacccgctattgatggcattttagcaggaaaagcttcc
ctccaaactgaggattttttattttttgctcaaatagcaagcaaacaagccttagcttcc
actaaagatatttttcaaaaaaatgattgtcctttttgctgttaa

DBGET integrated database retrieval system