KEGG   Onion yellows phytoplasma OY-M: PAM_170Help
Entry
PAM_170           CDS       T00154                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
poy  Onion yellows phytoplasma OY-M
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:poy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAM_170 (tpiA)
   01230 Biosynthesis of amino acids
    PAM_170 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAM_170 (tpiA)
   00051 Fructose and mannose metabolism
    PAM_170 (tpiA)
   00562 Inositol phosphate metabolism
    PAM_170 (tpiA)
Enzymes [BR:poy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PAM_170 (tpiA)
Exosome [BR:poy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PAM_170 (tpiA)
  Exosomal proteins of bladder cancer cells
   PAM_170 (tpiA)
  Exosomal proteins of melanoma cells
   PAM_170 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
200974..201798
Genome map
AA seq 274 aa AA seqDB search
MNYKPRTKVIAGNWKMYKCKDEALEFIQKVSLQVPDQTQVQTLIFPQLTLLDSLAQLQGT
NLQVGAQNMFYESEGAFTGEVSPQNLLSLGVKHVLLGHSERRTFFGETDQTVNLKLLSAL
KHKLVPTVCVGESLLTKENNQTQVFLDQQLTNIFAGVPEEALQNIIIAYEPVWAIGTGKS
ATPQDANKVIEQIRDKVTALYSSQASCAMRIIYGGSVSVANIKTILEQPAIDGILAGKAS
LQTEDFLFFAQIASKQALASTKDIFQKNDCPFCC
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaattacaaaccaagaacaaaagtgattgcaggtaattggaaaatgtacaaatgcaaa
gacgaagccctggaattcatccaaaaagtaagcttgcaagttcctgaccaaacccaagtc
caaactttaattttcccccaacttaccttattagattccttagcacaactccaaggcact
aatttacaagtaggggcccaaaatatgttttatgaatccgaaggcgcttttactggcgaa
gtttcaccacaaaatttgctttcattaggtgtcaagcacgttttattaggacacagcgaa
agaagaactttttttggagaaaccgatcaaacagttaatctaaaacttttatcagctctc
aaacacaaattagttcctactgtttgtgtgggcgaatcgcttcttaccaaggaaaataac
caaacccaagtttttttagaccaacaattaaccaacatttttgcaggtgttccagaagaa
gcattacaaaacatcatcatcgcttatgaaccggtttgggcaattggtacaggcaaaagt
gcaactccccaagatgctaacaaagtcattgaacaaatcagagacaaagtcactgcactt
tattcttcccaagcatcttgtgccatgagaattatttacggcggttcagtgtctgttgcc
aacattaaaaccattttagaacaacccgctattgatggcattttagcaggaaaagcttcc
ctccaaactgaggattttttattttttgctcaaatagcaagcaaacaagccttagcttcc
actaaagatatttttcaaaaaaatgattgtcctttttgctgttaa

DBGET integrated database retrieval system