KEGG   Onion yellows phytoplasma OY-M: PAM_281Help
Entry
PAM_281           CDS       T00154                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
poy  Onion yellows phytoplasma OY-M
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:poy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAM_281 (pfkA)
   01230 Biosynthesis of amino acids
    PAM_281 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAM_281 (pfkA)
   00030 Pentose phosphate pathway
    PAM_281 (pfkA)
   00051 Fructose and mannose metabolism
    PAM_281 (pfkA)
   00052 Galactose metabolism
    PAM_281 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    PAM_281 (pfkA)
Enzymes [BR:poy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PAM_281 (pfkA)
Protein phosphatases and associated proteins [BR:poy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PAM_281 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
324839..325837
Genome map
AA seq 332 aa AA seqDB search
MKNENQKAKTKTKENKKIAVLTSGGDAPGMNAAIRALVFESAKQGFEVFGVKDGYLGLFN
NQIEILNPQTFPRVLNVSGTFLGTSRFLDFQNNLDVRKQCAQNLKTLGIDKLVVIGGDGS
YKGASKLHELGIKCVGLPATIDNDICATDFTIGFSTALNNIVDAIEKLRDTSVSHNRCSI
IEVMGRHKGDLALFGGLAAGADVIVTRENLLSQKTICQKIKSLRQANQRHAIVVVTEHIF
DVASLAKEVENYSGFETRAQVLGHIQRGGKPTAEDLVLAFRMGSYAVSLLQQNIFNCAVG
TCGLNLHYTTFGDLFEKTYEKNELFNVVAKLL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgaaaaccaaaaagcaaaaacaaaaacaaaagaaaacaaaaaaattgctgtg
ttaacttcaggcggcgatgctcctggaatgaatgcagctattcgtgctttagtttttgaa
agcgctaaacaaggatttgaagttttcggcgtaaaagatggttatttaggactttttaat
aaccaaatcgaaatcttaaatcctcaaacatttcctcgtgttcttaatgtgtctggtact
tttttgggaacttctcgttttttagattttcaaaataatttagatgttcgcaagcaatgc
gcccaaaatttaaaaactttaggaattgataaattagttgtaattggtggtgatggttct
tataaaggagcatccaaattgcacgaacttggcatcaaatgcgtaggactgccagccacc
attgacaatgatatttgtgccactgattttactattggatttagcactgctctcaataat
attgtagatgccattgaaaaattgcgcgatacttctgtttctcacaaccgatgcagtatt
attgaagtgatgggacgccacaaaggggatttggctttatttggtggacttgctgcagga
gcagacgttattgttactcgcgaaaatcttttatcccaaaaaactatttgccaaaaaatt
aaatctttgcgccaagcaaaccaaagacatgctattgtagttgtcactgaacatattttt
gatgttgcaagtttagccaaagaggtagaaaattacagtggtttcgaaactagagcccaa
gttttaggacacattcaaagaggtggtaaaccaactgcagaagatctagtccttgctttt
agaatgggaagttatgccgtttctttattgcaacaaaacatttttaattgtgctgttggc
acttgcggacttaatttgcattacactacttttggtgatctttttgaaaaaacttatgaa
aaaaatgaattatttaatgtagtagctaaattgttgtaa

DBGET integrated database retrieval system