KEGG   Onion yellows phytoplasma OY-M: PAM_290Help
Entry
PAM_290           CDS       T00154                                 

Gene name
argE
Definition
acetylornithine deacetylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
poy  Onion yellows phytoplasma OY-M
Pathway
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:poy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAM_290 (argE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    PAM_290 (argE)
Enzymes [BR:poy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PAM_290 (argE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
337963..339339
Genome map
AA seq 458 aa AA seqDB search
MIDFKKEVLKRKDALIEALQTLLKINTELTTFDPNRTGAPFGEGNQQALDFMLDLGSQSG
FKTLNLEGYAGHIEYGNQKEWVGMIGHLDVVPAGTGWDYPPYAALIVDGTLYGRGTQDDK
GPTMAAFWALKILHELNLPLSKRIKLILGVDEETGFRCMKHYFKQIPELPVSGFVPDSHF
PAIYCEKGIGGFTFEGTVLDNRIVSIQSGQASNVVPDLAQAVLKFDPNYSDLFHNFVKNN
SIKATLEPQGDLLKLEVHGVSAHGSTPETGKNALYDLMKVLKALGITNTLVDFFDQYLVD
SLDGKKLGINHFDEETYNLVCFSGVLKLENNQAFFTLNLRYPKGITFEKILFQLEKAAKS
QHFCLKTTLHHPIMYVDPKSELMQTLLKVYQKHTNDLVSKPMCVGGGSFAKCAPNLVPFG
PTFVDEVSLIHQKNESISIDKLITLTAIYTEALYELAK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgattgattttaaaaaagaggttttaaaaagaaaagacgccttaattgaggctttgcaa
acattattaaaaattaacactgaacttaccacctttgatcctaatagaacaggcgctcct
tttggcgaaggaaatcaacaagcccttgattttatgcttgatttaggctcccaaagcggc
tttaaaaccctgaatttagaaggatacgctggtcatattgaatacggcaaccaaaaagaa
tgggttggtatgattggtcatttggatgtagtgccagcaggaactggttgggactatcca
ccttatgcggctttaattgttgatggcacgctttatggcagaggaacccaagacgataaa
ggtcctacaatggcagctttctgggctttgaaaatattgcacgaactaaatttgccgctt
tccaaaagaattaaattaattttgggtgtcgatgaagaaactggatttcgttgtatgaaa
cactattttaaacaaatccctgaattacctgtgtctggttttgttcctgacagccatttt
cctgctatttattgcgaaaaaggaattgggggttttacttttgaaggcacagttttagat
aatagaattgtaagtattcaaagcgggcaagcctctaatgttgttcctgatttggcacaa
gcagttctaaaatttgatcctaactactcagatttattccataattttgttaaaaacaac
agcatcaaagccactttagaaccacaaggcgatttgttaaagcttgaagttcacggcgtt
tctgcgcatggttcgactcctgaaacaggaaaaaatgccctttatgatttgatgaaagtt
cttaaagcattgggaattacaaatactttggttgatttttttgatcaatatttggtagat
agtttggatggaaaaaaattaggcattaatcactttgatgaagaaacttataatttggtt
tgtttttctggagttttaaaattagaaaataatcaagcttttttcactcttaatttaaga
tatcctaaaggaattacatttgaaaaaatcctttttcaattggaaaaagcagccaagagc
caacatttttgcctcaaaactacccttcatcatcccattatgtatgttgatcctaaaagt
gaattaatgcaaacattattaaaagtttatcaaaaacatactaatgatttagtttccaaa
cctatgtgtgtgggtggtggttcttttgcaaaatgcgcccctaatttagtaccttttgga
cctacttttgtcgatgaagtttctttaattcatcaaaaaaatgaatctatttcaattgat
aaattaattaccttaactgccatttacacagaagctttatatgaattagcaaaataa

DBGET integrated database retrieval system