KEGG   Onion yellows phytoplasma OY-M: PAM_294Help
Entry
PAM_294           CDS       T00154                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
poy  Onion yellows phytoplasma OY-M
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:poy00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:poy00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
341235..341726
Genome map
AA seq 163 aa AA seqDB search
MINLITAFDGNYLIGKDNKLPWHYSQDLQYFKKITLNQNVLMGYETYKSLKNYFKNKPFN
FKKTYVASLKHDLELPNCTVVSDLQSFMASDAAQDIFIIGGGKIYQQTLPWVTTLYITHI
LQRHQGNVFFPKIDLSQYQLIQKEIHPQLIFAIYQKKLDTPKC
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgattaatttaattactgcctttgacggcaattatttgattggcaaagacaacaaacta
ccttggcattattcccaagatttacaatattttaaaaaaattacccttaatcaaaatgtt
ttaatggggtatgaaacttataaatccttaaaaaattatttcaaaaataagccctttaat
tttaaaaaaacttatgtagcatctttaaaacatgatttggaattgcctaattgtactgtt
gtttctgatttgcaatccttcatggcaagtgatgctgcccaagatatttttattattggt
ggaggaaaaatctatcaacaaaccctaccttgggtaacaactttatacatcacccacatt
ttacaaagacatcaaggaaatgttttttttcccaaaattgacttatcacaataccaatta
atccaaaaagaaattcacccacaattaatttttgccatttatcaaaagaaattagatacg
cccaaatgttaa

DBGET integrated database retrieval system