KEGG   Onion yellows phytoplasma OY-M: PAM_580Help
Entry
PAM_580           CDS       T00154                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
poy  Onion yellows phytoplasma OY-M
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:poy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PAM_580 (folK)
Enzymes [BR:poy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PAM_580 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(650123..650638)
Genome map
AA seq 171 aa AA seqDB search
MKLNNNVAAIGLGSNLGAKKNNLQTALKMINLHPQCEVLKVSPLYATLPWGKTDQPLFLN
AAALIKTFLPPLLFLDFLLSVEMKLKRKRLELWGPRTIDLDIFFLGNHTCKTPKLTIPHP
YMLERIFVLAPLADILPNQIIQTKTILEWKNQLDQNAVKIIENNQWYQPSF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaataacaatgtagcagccataggacttggtagtaatctgggagctaaaaag
aataatttacaaactgctttaaaaatgattaatttgcatcctcaatgcgaagttttgaaa
gtttctcctttgtatgcaactcttccttggggaaaaacagaccaacctttatttttaaac
gctgctgctcttatcaaaactttcctacctcccttactttttttagattttttattatct
gtagaaatgaaactcaaaagaaaacgactagaattatggggaccgcgtactattgattta
gatattttttttttgggtaatcatacttgcaaaactcctaaattaactattcctcatccc
tatatgttagaaagaatttttgtccttgctcccttagcagatattttacctaaccaaata
atacaaaccaaaactattttagaatggaaaaaccaattagatcaaaatgcagttaaaata
attgaaaataatcaatggtatcaaccttctttttaa

DBGET integrated database retrieval system