KEGG   Onion yellows phytoplasma OY-M: PAM_580Help
Entry
PAM_580           CDS       T00154                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
poy  Onion yellows phytoplasma OY-M
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:poy00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(650123..650638)
Genome map
AA seq 171 aa AA seqDB search
MKLNNNVAAIGLGSNLGAKKNNLQTALKMINLHPQCEVLKVSPLYATLPWGKTDQPLFLN
AAALIKTFLPPLLFLDFLLSVEMKLKRKRLELWGPRTIDLDIFFLGNHTCKTPKLTIPHP
YMLERIFVLAPLADILPNQIIQTKTILEWKNQLDQNAVKIIENNQWYQPSF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaataacaatgtagcagccataggacttggtagtaatctgggagctaaaaag
aataatttacaaactgctttaaaaatgattaatttgcatcctcaatgcgaagttttgaaa
gtttctcctttgtatgcaactcttccttggggaaaaacagaccaacctttatttttaaac
gctgctgctcttatcaaaactttcctacctcccttactttttttagattttttattatct
gtagaaatgaaactcaaaagaaaacgactagaattatggggaccgcgtactattgattta
gatattttttttttgggtaatcatacttgcaaaactcctaaattaactattcctcatccc
tatatgttagaaagaatttttgtccttgctcccttagcagatattttacctaaccaaata
atacaaaccaaaactattttagaatggaaaaaccaattagatcaaaatgcagttaaaata
attgaaaataatcaatggtatcaaccttctttttaa

DBGET integrated database retrieval system