KEGG   Onion yellows phytoplasma OY-M: PAM_594Help
Entry
PAM_594           CDS       T00154                                 

Gene name
asnB
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
poy  Onion yellows phytoplasma OY-M
Pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
670192..671868
Genome map
AA seq 558 aa AA seqDB search
MCSIFGILNIKTDPQILRDQALKLSSLMRHRGPDWSRIFASQKAILAHERLSIIDVNAGA
QPLYNKTKTLILAINGEIYNHLDLRKQYKDKYEFQKESDCEVILALYQEKGVNFLDELQG
MFAFILYDLTKNTYLIGRDHMGIIPLYMGYYLNQNFYIASEMKALIPICQTLSIFPPGNY
LYSESGKMVKYYKRNWMDYQNVYNNQTNTNQLRNFLEASVKKILMSDVPYGVLLSGGLDS
SIISGITKKFAKHRIEESSKKEVCFPSLHSFAVGLKGAPDLKAAKEVDNHLGTAHHEINF
TIQEGIDALKDVIYHIETYDITTIRASIPMYLMARKIKAMGIKMILSGEGADEIFGGYLY
FHKAPNAQEFHKETVRKLASLHLYDCSRANKAMSAWGVEARVPFLDKNFLDVAMRLNPKD
KMCGTNGKIEKHILRQTFESYLPKKIVWRQKEQFSDGVGYSWIDALKQLAQTKITDTQLK
NAYVRFPYNTPTNKEGYMYREIFEILFPLPSAISLFPGGPSIACCTAKAIEWDKAFKQIN
DPSGRAALGVHNEAYKDK
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaatttttggaatactaaatattaaaaccgatccacaaattttgcgtgaccaa
gctcttaaactttcaagtttgatgcgtcatcgaggacctgattggtcaagaatttttgcc
tctcaaaaagccattttagcacacgaaagactatcaattatagatgttaatgctggagct
caaccactttataataaaaccaaaaccttaatacttgcaataaatggagaaatttataac
cacctagatttacgcaaacaatacaaagataaatacgaatttcaaaaagaatcagattgt
gaagttattctagcactatatcaagaaaaaggtgttaattttttagatgaattacaagga
atgtttgcatttattttatatgatcttacaaaaaacacctatcttataggacgcgatcat
atgggaataattccactttatatgggatattaccttaaccaaaatttttatatagcttct
gaaatgaaagccttaattcccatttgccaaaccctttctatttttcctccaggaaattat
ttatatagtgaatctggcaaaatggtgaaatattataaacgcaattggatggattatcaa
aatgtttacaacaaccaaaccaacacaaaccaattacgcaattttcttgaagcatcagta
aaaaaaattttaatgtctgatgttccttatggcgtacttttatctggtggtcttgactct
tctattatttctggaatcactaaaaaatttgccaaacaccgcatagaagaatcaagtaaa
aaagaggtttgttttccttcacttcattcttttgctgtaggtcttaaaggcgctcctgat
cttaaagctgccaaagaagtagacaatcatttaggaacagcccatcatgaaattaatttt
actattcaagaaggcatagatgctttaaaagatgttatttatcacattgaaacgtatgat
attacaactattcgcgcatcaattcctatgtatttaatggctcgcaaaattaaagctatg
ggaatcaaaatgattctttctggtgaaggtgctgatgagatttttggaggttatctatat
tttcataaagcccctaatgctcaagaattccacaaagaaacagtccgtaaattagcttca
ttacatttatatgattgttcacgagccaacaaagcaatgagtgcttggggagtagaggcg
cgagtgcctttcttagacaaaaactttttagatgttgctatgagacttaatcccaaagat
aaaatgtgtggcacaaatggcaaaatagaaaaacatattctacgacaaacatttgaatct
tatttacccaaaaagattgtatggcgccaaaaagaacaattttctgatggagtaggctac
agttggattgatgctttaaaacaacttgcccaaaccaaaatcacagatacacaattaaaa
aatgcttatgttcgtttcccttacaatactcctacaaacaaagaaggctacatgtatcgc
gaaatttttgaaatcttatttcctttgccaagtgcaataagtctttttcctggtggtcct
tcaattgcttgctgtactgcaaaagctatcgaatgggacaaagcttttaaacaaataaac
gacccttcaggacgtgctgcattaggagtgcataatgaagcttataaggacaaataa

DBGET integrated database retrieval system