KEGG   Onion yellows phytoplasma OY-M: PAM_723Help
Entry
PAM_723           CDS       T00154                                 

Definition
hypothetical protein
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
poy  Onion yellows phytoplasma OY-M
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:poy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAM_723
Enzymes [BR:poy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     PAM_723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(814922..816133)
Genome map
AA seq 403 aa AA seqDB search
MFDFMINHLSSKSLMYQDFKKNHNNSQYKDFFLRWEKFWQQVGPNRPTKQDVDSIYKRKD
KAPTHLIEFDDGTTEHLWNTFGTDQIDLNVKEPIVKEFIKTTLTNMVKQGASIIRLDAFA
YACKKADTSFFVEPDIWQLLDEVRDVLKPLDVELLPEIHENHSISHKISEHGYFIYDFAL
PLVVLYTLYSKNPQRLVEWLKKSPMKKFTTLDTHDGIGVIDAYDILTDKEIKYTSEQLYK
QGANVKKVYSSSLYNNLDIYQINFTYYSALGNDDDAYLLSRAFQIFAPGIPQVYYVCLFA
GENDIKLLESSKEGRNTNRHYYSRQEIKEEVKRPVVANLFKLLAWRNKSNAFDLDGVMEC
SAYASKIKILRKDKLGNNVAVLDADLMNKKFVIVENDKQIFSN
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtttgattttatgattaatcatctttcatctaagtctttgatgtatcaagattttaaa
aagaatcataataattctcagtataaagatttttttctacgttgggaaaagttttggcaa
caagtaggacctaatagaccaaccaaacaagatgtagattctatttataaacgtaaagat
aaagctcctactcatttaattgaatttgatgatggtactactgaacatctttggaatact
tttggcaccgatcaaattgatcttaatgttaaagagcctattgttaaagaatttattaaa
actactttaactaatatggtaaaacaaggtgcaagtattattcgtcttgatgcttttgct
tatgcttgtaaaaaagctgatactagtttttttgtagaacctgatatatggcaattactt
gatgaagtaagagatgtattaaagcctttggatgtagaattattaccagaaattcatgaa
aatcatagtatttcacataagattagtgagcatggatactttatttatgattttgctctt
cctcttgttgttctttatactctttattctaaaaatcctcaacgtttagtggagtggttg
aaaaaatctccaatgaaaaaatttactaccttagatactcatgatggtattggagtaatt
gatgcttatgatattttaactgataaagaaattaagtatacttctgaacaattatataaa
caaggtgctaatgttaaaaaagtatattcttcatctctttataataatttagatatttat
caaattaattttacttattattctgctttaggaaatgatgacgatgcttatttattgagt
agagcttttcaaatctttgctccaggaatacctcaagtttattatgtttgtctttttgct
ggggaaaatgatattaaattattagaatcttctaaagaaggaagaaatactaatcgtcat
tattattctagacaagaaataaaagaagaagttaaacgtcctgtagtagctaatttattt
aagttgttggcttggagaaataaatctaatgcctttgatctagatggtgttatggaatgt
agtgcttatgcatctaaaattaaaatattgcgtaaagataaattaggtaataatgttgct
gttttagatgctgatttgatgaataaaaaatttgttattgttgaaaatgataaacaaata
tttagtaattaa

DBGET integrated database retrieval system