KEGG   Onion yellows phytoplasma OY-M: PAM_740Help
Entry
PAM_740           CDS       T00154                                 

Gene name
frvX
Definition
(GenBank) endo-1,4-beta-glucanase homolog
Organism
poy  Onion yellows phytoplasma OY-M
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(835931..836995)
Genome map
AA seq 354 aa AA seqDB search
MKMSDLVSLLKDLTMLNGIPGQEKAVANYVVDKIKNQVDSIEYDNLGSVIACKGKTGPRI
MFAGHLDEIGLIVKQITPEGFIKFQTLGGWFSQVMLAQVWQIHTDKGVLKAVTGCKPPHV
MSFQERNQVINTSSMYLDIGVANKEEALKLGVRVGDMVTPYIEFSTLGNSDYLLAKALDN
RVGVAIVMQVLENVNPTTNQFFGVFTTQEEVGLRGAQTSAHKVHPQIAIAVDTGIGNDVP
GGEKEGHTLGKGPQVLVYDGGLVAHKGLRNFVLKIAAQNNIPVQEISGSGGRTDAATMHL
VREGAASLSFGVPVRYIHSHTSVVHKQDIINTVKLLTLLVNQLDEKKVNEILFQ
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgagtgatttagtttctttattaaaagatttaacaatgttaaatggtattcca
ggtcaagaaaaagcagttgctaattatgtagttgacaaaatcaaaaaccaagtagactcc
atcgaatatgataatttaggctctgtgattgcttgtaaaggaaaaacaggacctcgcatt
atgtttgcaggacatttggatgaaataggcttaatagttaagcaaattactccagaaggt
tttatcaaattccaaactcttggtggttggttttctcaagtgatgcttgctcaagtttgg
caaattcacaccgataaaggtgttcttaaagcagttactggttgcaaacctccgcatgta
atgtcttttcaagagcgcaatcaagttatcaacacttcttctatgtatttagatattgga
gttgccaacaaagaagaagccttaaaattaggcgttcgcgttggtgatatggtaactcct
tatatagaattcagcacgcttggtaattctgattatctccttgcaaaagccttagataat
cgcgtgggagttgcaattgtgatgcaagttttagaaaatgtcaatcctactaccaatcaa
ttttttggtgtttttactacccaagaagaagtaggactacgcggagctcaaaccagtgct
cacaaagtacaccctcaaattgctattgctgttgatactggtattggaaatgatgttcca
gggggcgaaaaagaagggcacactctaggaaaaggtcctcaagttttagtttatgatggg
ggcttagtcgctcacaaaggattgcgtaattttgtccttaaaatcgctgcccaaaacaat
atccctgtgcaagaaataagtggcagtggtggtagaactgatgctgcaactatgcattta
gtgcgcgaaggagccgcttccttatcttttggcgttcctgtacgctacattcattcccac
acttctgtagttcacaaacaagacatcataaacactgttaaacttttaactttgttagta
aatcaattagacgaaaaaaaagttaacgaaattttatttcaataa

DBGET integrated database retrieval system